EXOS4_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: EXOS4_MOUSE
• UniProt AC: Q921I9
• Protein Name: Exosome complex component RRP41
• Gene Name: Exosc4
• Organism: Mus musculus (Mouse).
• Sequence Length: 245
• Subcellular Localization: Cytoplasm. Nucleus, nucleolus. Nucleus.
• Protein Description: Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes. EXOSC4 binds to ARE-containing RNAs (By similarity)..
• Protein Sequence: MAGLELLSDQGYRIDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRGSRSRALPDRALVNCQYSSATFSTGERKRRPHGDRKSCEMGLQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVNAATLAVMDAGIPMRDFVCACSAGFVDGTALADLSHVEEAAGGPQLALALLPASGQIALLEMDSRLHEDHLEQVLEAAAQAARGVHTLLDLVVRQHVQEASVSLGD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAGLELLSD ------CCCCEEECC	31.14	-
61	Phosphorylation	GPHEIRGSRSRALPD CCCCCCCCCCCCCCC	19.75	22871156
63	Phosphorylation	HEIRGSRSRALPDRA CCCCCCCCCCCCCCE	24.49	22871156
95	Malonylation	RRPHGDRKSCEMGLQ CCCCCCHHHHHHHHH	65.28	26320211

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of EXOS4_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of EXOS4_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of EXOS4_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.