dbPTM

EXO5_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	EXO5_SCHPO
UniProt AC	Q9Y7L4
Protein Name	Probable exonuclease V, mitochondrial
Gene Name	exo5
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	409
Subcellular Localization	Cytoplasm . Nucleus . Mitochondrion.
Protein Description	Single strand DNA specific 5' exonuclease involved in mitochondrial DNA replication and recombination. Releases dinucleotides as main products of catalysis. Has the capacity to slide across 5'double-stranded DNA or 5'RNA sequences and resumes cutting two nucleotides downstream of the double-stranded-to-single-stranded junction or RNA-to-DNA junction, respectively (By similarity)..
Protein Sequence	MEEYEDFEMEDLSELVSYMDYLETQRLTISQLDYSLSIPPQLLVSREISKLEDEVCEMLKESSLFQLFRKHKGYLNVTDLVLPLWCEVQHEYYLLRRIKKKTPKMERGIKLHQILEYETSPPSERRVLDRTSKEEPWALRLLRQLEGIMLLQKNGITREFPIWGYYKESSIFGIIDEISLNNPSKSNFNSDIRNYFNFKMYDLSFVDNKTRFSSRKPGASQILSSKVQLMYYVHLFLNYFPSLGEKQQSIFRDISPTYSNRLHSQSHWWNMFLSQLSLDGTKDLGPKFLEQSILSIPDIPEDVFAGHNSLNGLYALVFASAKKLHLRLTDDNLTIAYRNDKTGEVVYKDKFSFSNKLLEASYTKAYQFWHNLREPEGVPAEEVYKCRSCEFQKECWWLKKKQYYPLSSP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of EXO5_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of EXO5_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of EXO5_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of EXO5_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of EXO5_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of EXO5_SCHPO

Related Literatures of Post-Translational Modification