EVX1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: EVX1_HUMAN
• UniProt AC: P49640
• Protein Name: Homeobox even-skipped homolog protein 1
• Gene Name: EVX1
• Organism: Homo sapiens (Human).
• Sequence Length: 407
• Subcellular Localization: Nucleus.
• Protein Description: May play a role in the specification of neuronal cell types..
• Protein Sequence: MESRKDMVVFLDGGQLGTLVGKRVSNLSEAVGSPLPEPPEKMVPRGCLSPRAVPPATRERGGGGPEEEPVDGLAGSAAGPGAEPQVAGAAMLGPGPPAPSVDSLSGQGQPSSSDTESDFYEEIEVSCTPDCATGNAEYQHSKGSGSEALVGSPNGGSETPKSNGGSGGGGSQGTLACSASDQMRRYRTAFTREQIARLEKEFYRENYVSRPRRCELAAALNLPETTIKVWFQNRRMKDKRQRLAMTWPHPADPAFYTYMMSHAAAAGGLPYPFPSHLPLPYYSPVGLGAASAASAAASPFSGSLRPLDTFRVLSQPYPRPELLCAFRHPPLYPGPAHGLGASAGGPCSCLACHSGPANGLAPRAAAASDFTCASTSRSDSFLTFAPSVLSKASSVALDQREEVPLTR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
157	Phosphorylation	VGSPNGGSETPKSNG CCCCCCCCCCCCCCC	39.43	22210691
162	Phosphorylation	GGSETPKSNGGSGGG CCCCCCCCCCCCCCC	41.74	22210691
171	Phosphorylation	GGSGGGGSQGTLACS CCCCCCCCCCEEECC	28.81	22210691

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of EVX1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of EVX1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of EVX1_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of EVX1_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.