UniProt ID | EVA1B_HUMAN | |
---|---|---|
UniProt AC | Q9NVM1 | |
Protein Name | Protein eva-1 homolog B | |
Gene Name | EVA1B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 165 | |
Subcellular Localization |
Membrane Single-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MDAPRRDMELLSNSLAAYAHIRANPESFGLYFVLGVCFGLLLTLCLLVISISWAPRPRPRGPAQRRDPRSSTLEPEDDDEDEEDTVTRLGPDDTLPGPELSAEPDGPLNVNVFTSAEELERAQRLEERERILREIWRTGQPDLLGTGTLGPSPTATGTLGRMHYY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
70 | Phosphorylation | AQRRDPRSSTLEPED CCCCCCCCCCCCCCC | 23911959 | ||
71 | Phosphorylation | QRRDPRSSTLEPEDD CCCCCCCCCCCCCCC | 23911959 | ||
72 | Phosphorylation | RRDPRSSTLEPEDDD CCCCCCCCCCCCCCC | 25554490 | ||
85 | Phosphorylation | DDEDEEDTVTRLGPD CCCCCCCCHHCCCCC | 28355574 | ||
87 | Phosphorylation | EDEEDTVTRLGPDDT CCCCCCHHCCCCCCC | 30175587 | ||
94 | Phosphorylation | TRLGPDDTLPGPELS HCCCCCCCCCCCCCC | 26657352 | ||
101 | Phosphorylation | TLPGPELSAEPDGPL CCCCCCCCCCCCCCC | 28348404 | ||
114 | Phosphorylation | PLNVNVFTSAEELER CCEEEEECCHHHHHH | 30266825 | ||
115 | Phosphorylation | LNVNVFTSAEELERA CEEEEECCHHHHHHH | 19664994 | ||
138 | Phosphorylation | ILREIWRTGQPDLLG HHHHHHHHCCCCCCC | 29255136 | ||
146 | Phosphorylation | GQPDLLGTGTLGPSP CCCCCCCCCCCCCCC | 29255136 | ||
148 | Phosphorylation | PDLLGTGTLGPSPTA CCCCCCCCCCCCCCC | 29255136 | ||
152 | Phosphorylation | GTGTLGPSPTATGTL CCCCCCCCCCCCCCC | 29255136 | ||
154 | Phosphorylation | GTLGPSPTATGTLGR CCCCCCCCCCCCCCC | 29255136 | ||
156 | Phosphorylation | LGPSPTATGTLGRMH CCCCCCCCCCCCCCC | 23401153 | ||
158 | Phosphorylation | PSPTATGTLGRMHYY CCCCCCCCCCCCCCC | 29255136 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EVA1B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EVA1B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EVA1B_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of EVA1B_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...