| UniProt ID | EVA1B_HUMAN | |
|---|---|---|
| UniProt AC | Q9NVM1 | |
| Protein Name | Protein eva-1 homolog B | |
| Gene Name | EVA1B | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 165 | |
| Subcellular Localization |
Membrane Single-pass membrane protein . |
|
| Protein Description | ||
| Protein Sequence | MDAPRRDMELLSNSLAAYAHIRANPESFGLYFVLGVCFGLLLTLCLLVISISWAPRPRPRGPAQRRDPRSSTLEPEDDDEDEEDTVTRLGPDDTLPGPELSAEPDGPLNVNVFTSAEELERAQRLEERERILREIWRTGQPDLLGTGTLGPSPTATGTLGRMHYY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 70 | Phosphorylation | AQRRDPRSSTLEPED CCCCCCCCCCCCCCC | 23911959 | ||
| 71 | Phosphorylation | QRRDPRSSTLEPEDD CCCCCCCCCCCCCCC | 23911959 | ||
| 72 | Phosphorylation | RRDPRSSTLEPEDDD CCCCCCCCCCCCCCC | 25554490 | ||
| 85 | Phosphorylation | DDEDEEDTVTRLGPD CCCCCCCCHHCCCCC | 28355574 | ||
| 87 | Phosphorylation | EDEEDTVTRLGPDDT CCCCCCHHCCCCCCC | 30175587 | ||
| 94 | Phosphorylation | TRLGPDDTLPGPELS HCCCCCCCCCCCCCC | 26657352 | ||
| 101 | Phosphorylation | TLPGPELSAEPDGPL CCCCCCCCCCCCCCC | 28348404 | ||
| 114 | Phosphorylation | PLNVNVFTSAEELER CCEEEEECCHHHHHH | 30266825 | ||
| 115 | Phosphorylation | LNVNVFTSAEELERA CEEEEECCHHHHHHH | 19664994 | ||
| 138 | Phosphorylation | ILREIWRTGQPDLLG HHHHHHHHCCCCCCC | 29255136 | ||
| 146 | Phosphorylation | GQPDLLGTGTLGPSP CCCCCCCCCCCCCCC | 29255136 | ||
| 148 | Phosphorylation | PDLLGTGTLGPSPTA CCCCCCCCCCCCCCC | 29255136 | ||
| 152 | Phosphorylation | GTGTLGPSPTATGTL CCCCCCCCCCCCCCC | 29255136 | ||
| 154 | Phosphorylation | GTLGPSPTATGTLGR CCCCCCCCCCCCCCC | 29255136 | ||
| 156 | Phosphorylation | LGPSPTATGTLGRMH CCCCCCCCCCCCCCC | 23401153 | ||
| 158 | Phosphorylation | PSPTATGTLGRMHYY CCCCCCCCCCCCCCC | 29255136 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EVA1B_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EVA1B_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EVA1B_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of EVA1B_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...