UniProt ID | ETIF1_DROME | |
---|---|---|
UniProt AC | Q9VZS3 | |
Protein Name | Eukaryotic translation initiation factor eIF1 {ECO:0000305} | |
Gene Name | eIF1 {ECO:0000312|FlyBase:FBgn0035423} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 110 | |
Subcellular Localization | ||
Protein Description | Probably involved in translation.. | |
Protein Sequence | MSIQNLNTRDPFADAIKGNDDDIQDGLVHIRIQQRNGRKTLTTVQGLSAEYDLKKIVRSCKKEFACNGTVIEHPEYGEVLQLQGDQRENICQWLTKVGLAKPDQLKVHGF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSIQNLNTR ------CCCCCCCCC | 19429919 | ||
8 | Phosphorylation | MSIQNLNTRDPFADA CCCCCCCCCCHHHHH | 23607784 | ||
40 | Phosphorylation | QQRNGRKTLTTVQGL EEECCCEEEEEEECC | 22817900 | ||
42 | Phosphorylation | RNGRKTLTTVQGLSA ECCCEEEEEEECCCH | 21082442 | ||
43 | Phosphorylation | NGRKTLTTVQGLSAE CCCEEEEEEECCCHH | 21082442 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ETIF1_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ETIF1_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ETIF1_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
EIF3C_DROME | eIF3-S8 | physical | 14605208 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...