ESR2_ARATH - dbPTM
ESR2_ARATH - PTM Information in dbPTM
Basic Information of Protein
UniProt ID ESR2_ARATH
UniProt AC Q9FYK5
Protein Name Ethylene-responsive transcription factor ESR2
Gene Name ESR2
Organism Arabidopsis thaliana (Mouse-ear cress).
Sequence Length 306
Subcellular Localization Nucleus .
Protein Description Required for correct embryo patterning and cotyledon organogenesis. May regulate positively the gibberellin signaling pathway leading to germination, hypocotyl elongation, and leaf expansion. Involved in the cytokinin signaling pathway that promotes shoot regeneration, probably through transcriptional activation of target genes such as CUC1. Acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity)..
Protein Sequence MEEAIMRLEGAEHRETNIHSLKRKPSRTSSTAPGSPGGVTTAKAASGAGASGVSTIRYRGVRRRPWGRYAAEIRDPLSKERRWLGTFDTAEEAACAYDCAARAMRGLKARTNFVYPMPSLDSYHHRIFSSPPMNMFLLRDVLNSQSLSPLTTFAYPPCNLSNVNDVVHESFTNVNDVCEDLSPKAKRSSTIENESLISNIFEPEPASSGLLQEIVQGFLPKPISQHASIPPKSNQQSVGVFPTMPESGFQTDVRLADFHVEGNGFGQVKYHGELGWADHENGFDSAKMQQNGNGGMFYQYCFHDDY
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of ESR2_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of ESR2_ARATH !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of ESR2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of ESR2_ARATH !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions
ATBH9_ARATHPHVphysical
17376809

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of ESR2_ARATH

loading...

Related Literatures of Post-Translational Modification

TOP