dbPTM

ESM1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ESM1_HUMAN
UniProt AC	Q9NQ30
Protein Name	Endothelial cell-specific molecule 1
Gene Name	ESM1
Organism	Homo sapiens (Human).
Sequence Length	184
Subcellular Localization	Secreted.
Protein Description	Involved in angiogenesis; promotes angiogenic sprouting. May have potent implications in lung endothelial cell-leukocyte interactions..
Protein Sequence	MKSVLLLTTLLVPAHLVAAWSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
64	Phosphorylation	CAAGRGETCYRTVSG ECCCCCCCEEEEECC	20.05	22210691
66	Phosphorylation	AGRGETCYRTVSGMD CCCCCCEEEEECCCC	19.42	22210691
140	Phosphorylation	PFFQYSVTKSSNRFV CEEEEEEECCCCCEE	21.19	-
156	O-linked_Glycosylation	LTEHDMASGDGNIVR ECCCHHCCCCCCEEE	30.68	20581009

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ESM1_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ESM1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ESM1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of ESM1_HUMAN !!

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ESM1_HUMAN

Related Literatures of Post-Translational Modification

O-linked Glycosylation
Reference	PubMed
"Characterization and binding activity of the chondroitin/dermatansulfate chain from Endocan, a soluble endothelial proteoglycan."; Sarrazin S., Lyon M., Deakin J.A., Guerrini M., Lassalle P.,Delehedde M., Lortat-Jacob H.; Glycobiology 20:1380-1388(2010). Cited for: GLYCOSYLATION AT SER-156.	20581009 [Abstract]