| UniProt ID | ESM1_ARATH | |
|---|---|---|
| UniProt AC | Q9LJG3 | |
| Protein Name | GDSL esterase/lipase ESM1 | |
| Gene Name | ESM1 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 392 | |
| Subcellular Localization | Secreted . | |
| Protein Description | Represses or inhibits nitriles production from methionine-derived and from indol-3-ylmethyl glucosinolates. Favors isothiocyanate production.. | |
| Protein Sequence | MADNLNLVSVLGVLLVLTIFHNPIIVYAGEGVPNVALFTFGDSYYDAGNKVFLSQRKDLPQTYWPYGKSRDYPNGKFSDGHIVPDFIADFISIPNGVLPPVLKPGVDISRGVSFAVADASILGAPVESMTLNQQVVKFKNMKSNWNDSYIEKSLFMIYIGTEDYLNFTKANPNADASAQQAFVTNVINRLKNDIKLLYSLGASKFVVQLLAPLGCLPIVRQEYKTGNECYELLNDLAKQHNGKIGPMLNEFAKISTSPYGFQFTVFDFYNAVLRRIATGRSLNYRFFVTNTSCCGVGTHNAYGCGKGNVHSKLCEYQRSYFFFDGRHNTEKAQEEMAHLLYGADPDVVQPMTVRELIVYPTGETMREYWEPNNLAIRRRPSRDFYLGLAAYY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 146 | N-linked_Glycosylation | KNMKSNWNDSYIEKS HCCCCCCCHHHHHHE | 32.38 | - | |
| 166 | N-linked_Glycosylation | IGTEDYLNFTKANPN ECCHHHHCCCCCCCC | 35.99 | - | |
| 177 | Phosphorylation | ANPNADASAQQAFVT CCCCCCHHHHHHHHH | 27.45 | 29654922 | |
| 198 | Phosphorylation | KNDIKLLYSLGASKF HHHHHHHHHCCCCHH | 16.58 | 19880383 | |
| 199 | Phosphorylation | NDIKLLYSLGASKFV HHHHHHHHCCCCHHH | 21.94 | 19880383 | |
| 203 | Phosphorylation | LLYSLGASKFVVQLL HHHHCCCCHHHHHHH | 25.48 | 25561503 | |
| 247 | Sulfoxidation | HNGKIGPMLNEFAKI CCCCCHHHHHHHHHH | 5.46 | 25693801 | |
| 290 | N-linked_Glycosylation | NYRFFVTNTSCCGVG EEEEEEECCCCCCCC | 25.37 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ESM1_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ESM1_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ESM1_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ESM1_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
