dbPTM

ERP29_CHICK - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ERP29_CHICK
UniProt AC	P81628
Protein Name	Endoplasmic reticulum resident protein 29
Gene Name	ERP29
Organism	Gallus gallus (Chicken).
Sequence Length	228
Subcellular Localization	Endoplasmic reticulum lumen.
Protein Description	Does not seem to be a disulfide isomerase. Plays an important role in the processing of secretory proteins within the endoplasmic reticulum (ER), possibly by participating in the folding of proteins in the ER..
Protein Sequence	MAAAAAAGSLLLCLLGLALPGSALHTKGSVPLDTITFYKVIPKHKFVLVKFDTQYPYGEKQDEFKKLAESSGSSEDLLVAEVGISDYGDKLNTELGEKYKLDKEKYPIFYLFHDGDFDNPLPYSGHIKAGAIQRWLKSNGIYLGMPGCLKEYDVLASKFMSVTDKSERQSLLKKGQQSLEKAKETEKKSAEQYLKIMSKILEQGEEFAANEVVRITKLIEKTKMSDGK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of ERP29_CHICK !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ERP29_CHICK !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ERP29_CHICK !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ERP29_CHICK !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of ERP29_CHICK !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ERP29_CHICK

Related Literatures of Post-Translational Modification