dbPTM

ERF83_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ERF83_ARATH
UniProt AC	Q9LDE4
Protein Name	Ethylene-responsive transcription factor 7
Gene Name	ERF7
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	244
Subcellular Localization	Nucleus .
Protein Description	Involved in the regulation of gene expression by abscisic acid, stress factors and by components of stress signal transduction pathways. Transcription factor that binds to the GCC-box pathogenesis-related promoter element. Part of a transcriptional repressor complex including a histone deacetylase..
Protein Sequence	MRKGRGSSVVGPALPVTAGGSVKEPRYRGVRKRPWGRFAAEIRDPLKKSRVWLGTFDSAVDAARAYDTAARNLRGPKAKTNFPIDCSPSSPLQPLTYLHNQNLCSPPVIQNQIDPFMDHRLYGGGNFQEQQQQQIISRPASSSMSSTVKSCSGPRPMEAAAASSSVAKPLHAIKRYPRTPPVAPEDCHSDCDSSSSVIDDGDDIASSSSRRKTPFQFDLNFPPLDGVDLFAGGIDDLHCTDLRL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
141	Phosphorylation	QIISRPASSSMSSTV HHHHCCCCCCCCCCC	26.15	25561503
142	Phosphorylation	IISRPASSSMSSTVK HHHCCCCCCCCCCCH	31.97	25561503
143	Phosphorylation	ISRPASSSMSSTVKS HHCCCCCCCCCCCHH	21.86	25561503
145	Phosphorylation	RPASSSMSSTVKSCS CCCCCCCCCCCHHCC	25.46	25561503
146	Phosphorylation	PASSSMSSTVKSCSG CCCCCCCCCCHHCCC	28.69	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ERF83_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ERF83_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ERF83_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
CIPKF_ARATH	CIPK15	physical	15994908

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ERF83_ARATH

Related Literatures of Post-Translational Modification