ERF56_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ERF56_ARATH
• UniProt AC: Q9SIE4
• Protein Name: Ethylene-responsive transcription factor ERF056
• Gene Name: ERF056
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 261
• Subcellular Localization: Nucleus .
• Protein Description: Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity)..
• Protein Sequence: METASLSFPVPNTSFGVNKSMPLGLNQLTPYQIHQIQNQLNHRRSTISNLSPNRIRMKNLTPSTSKTKNLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFETAEKAALAYDQAAFQLRGDIAKLNFPNLIHEDMNPLPSSVDTKLQAICKSLRKTEEICSVSDQTKEYSVYSVSDKTELFLPKAELFLPKREHLETNELSNESPRSDETSLLDESQAEYSSSDKTFLDFSDTEFEEIGSFGLRKFPSVEIDWDAISKLANS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
160	Phosphorylation	RKTEEICSVSDQTKE HCCHHHCCCCCCCCE	30.25	28295753
162	Phosphorylation	TEEICSVSDQTKEYS CHHHCCCCCCCCEEE	14.01	28295753
165	Phosphorylation	ICSVSDQTKEYSVYS HCCCCCCCCEEEEEE	30.73	28295753

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ERF56_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ERF56_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ERF56_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of ERF56_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.