UniProt ID | ERD23_MOUSE | |
---|---|---|
UniProt AC | Q8R1L4 | |
Protein Name | ER lumen protein-retaining receptor 3 | |
Gene Name | Kdelr3 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 214 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein. |
|
Protein Description | Required for the retention of luminal endoplasmic reticulum proteins. Determines the specificity of the luminal ER protein retention system. Also required for normal vesicular traffic through the Golgi. This receptor recognizes K-D-E-L (By similarity).. | |
Protein Sequence | MNVFRILGDLSHLLAMILLLVKIWRSKSCAGISGKSQILFALVFTTRYLDLFSNFISIYNTVMKVVFLLCAYVTVYMIYWKFRKTFDIENDTFRLEFLLVPVTGLSFLVNYSYTPMEVLWTFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRLLYLANWIRRYQTENFYDQISVVSGVVQTIFYCDFFYLYVTKVLKGKKLSLPVPV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
209 | Phosphorylation | VLKGKKLSLPVPV-- HHCCCCCCCCCCC-- | 39.23 | 27180971 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ERD23_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ERD23_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ERD23_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ERD23_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...