ERD23_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ERD23_MOUSE
• UniProt AC: Q8R1L4
• Protein Name: ER lumen protein-retaining receptor 3
• Gene Name: Kdelr3
• Organism: Mus musculus (Mouse).
• Sequence Length: 214
• Subcellular Localization: Endoplasmic reticulum membrane; Multi-pass membrane protein.
• Protein Description: Required for the retention of luminal endoplasmic reticulum proteins. Determines the specificity of the luminal ER protein retention system. Also required for normal vesicular traffic through the Golgi. This receptor recognizes K-D-E-L (By similarity)..
• Protein Sequence: MNVFRILGDLSHLLAMILLLVKIWRSKSCAGISGKSQILFALVFTTRYLDLFSNFISIYNTVMKVVFLLCAYVTVYMIYWKFRKTFDIENDTFRLEFLLVPVTGLSFLVNYSYTPMEVLWTFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRLLYLANWIRRYQTENFYDQISVVSGVVQTIFYCDFFYLYVTKVLKGKKLSLPVPV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
209	Phosphorylation	VLKGKKLSLPVPV-- HHCCCCCCCCCCC--	39.23	27180971

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ERD23_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ERD23_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ERD23_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of ERD23_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.