ERD22_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ERD22_HUMAN
• UniProt AC: P33947
• Protein Name: ER lumen protein-retaining receptor 2
• Gene Name: KDELR2
• Organism: Homo sapiens (Human).
• Sequence Length: 212
• Subcellular Localization: Endoplasmic reticulum membrane; Multi-pass membrane protein.
• Protein Description: Required for the retention of luminal endoplasmic reticulum proteins. Determines the specificity of the luminal ER protein retention system. Also required for normal vesicular traffic through the Golgi. This receptor recognizes K-D-E-L..
• Protein Sequence: MNIFRLTGDLSHLAAIVILLLKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYNTSMKVIYLACSYATVYLIYLKFKATYDGNHDTFRVEFLVVPVGGLSFLVNHDFSPLEILWTFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLVNWIWRFYFEGFFDLIAVVAGVVQTILYCDFFYLYITKVLKGKKLSLPA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
29	S-nitrosylation	KIWKTRSCAGISGKS HHHCCCCCCCCCCHH	3.47	2212679
83	Ubiquitination	YLIYLKFKATYDGNH HHHHHEEEEEECCCC	37.93	-
209	Phosphorylation	VLKGKKLSLPA---- HHCCCCCCCCC----	40.98	28355574

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ERD22_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ERD22_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ERD22_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of ERD22_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.