EPPI_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: EPPI_HUMAN
• UniProt AC: O95925
• Protein Name: Eppin
• Gene Name: EPPIN
• Organism: Homo sapiens (Human).
• Sequence Length: 133
• Subcellular Localization: Isoform 1: Secreted. Cell surface. Bound to the surface of testicular and on the head and tail of ejaculate spermatozoa.
• Protein Description: Serine protease inhibitor that plays an essential role in male reproduction and fertility. Modulates the hydrolysis of SEMG1 by KLK3/PSA (a serine protease), provides antimicrobial protection for spermatozoa in the ejaculate coagulum, and binds SEMG1 thereby inhibiting sperm motility..
• Protein Sequence: MGSSGLLSLLVLFVLLANVQGPGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQDNKKCCVFSCGKKCLDLKQDVCEMPKETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANCLNTCKNKRFP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
176	Phosphorylation	-------------------------------------------------- --------------------------------------------------		24719451
176 (in isoform 3)	Phosphorylation	-		24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of EPPI_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of EPPI_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of EPPI_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TRFL_HUMAN	LTF	physical	17567961
CLUS_HUMAN	CLU	physical	17567961
UMPS_HUMAN	UMPS	physical	28514442
GRP78_HUMAN	HSPA5	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.