dbPTM

EPL1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	EPL1_SCHPO
UniProt AC	Q9UU94
Protein Name	Enhancer of polycomb-like protein 1
Gene Name	epl1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	557
Subcellular Localization	Nucleus.
Protein Description	Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. The NuA4 complex is also involved in DNA repair. Involved in gene silencing by neighboring heterochromatin, blockage of the silencing spreading along the chromosome, and required for cell cycle progression through G2/M (By similarity)..
Protein Sequence	MSSVSKNARAYRQRKVGIKTVMPIYFERDIPDFDEEASLQRTVPLVESGVEKEEEEEKHLQQVINEAHEAIVRGSEKKLIIPTREAKNIGIIDKYYKKNFILPKTLIRFSLTVEECTNPEYCMDEHDTEYFLKLKQAQPSLSKFSELDFEIVMQTFEEEINQNQPFLSMDTSQILPLSELITSFELKDVLYLKPLASQVYPYWRERRISKGGLPIMAKAQVGDDKDDDDPYVCFRRREIRQARKTRRSDAQSYDRLRRLRQSMETSLQLLEQVYKREQKKLQALEDDYAIFQKRCLVKKLKRTLNIKDSDELLINPKRRPIEVKPAAPVPTPAPPVKTSPHPASYRPQPTRNVEVRPLLMLDDVQSAQITQFQIRLQQRLTKKEQLDRNWVDLLETPSTVIHTNYPDSFYRNIIPYYSGKETKQSHNQLSIPSSTPSTPLSDNGPTYSTPHSSLSNFNTCDSLSFSSNNSLYGYSTLLHPRNPICVRQRIGRGGRLMLDRTRALPVHRLSKPKSRVEDRWLFDIPFDADDTIILDDESDASIMFRASLLNDDMGTQS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
338	Phosphorylation	TPAPPVKTSPHPASY CCCCCCCCCCCCCCC	47.96	29996109
339	Phosphorylation	PAPPVKTSPHPASYR CCCCCCCCCCCCCCC	18.59	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of EPL1_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of EPL1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of EPL1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of EPL1_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of EPL1_SCHPO

Related Literatures of Post-Translational Modification