dbPTM

EPFL6_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	EPFL6_ARATH
UniProt AC	Q1PEY6
Protein Name	EPIDERMAL PATTERNING FACTOR-like protein 6 {ECO:0000303\|PubMed:19435754}
Gene Name	EPFL6 {ECO:0000303\|PubMed:19435754}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	156
Subcellular Localization	Secreted .
Protein Description	Acts primarily as positive regulator of inflorescence growth. Endodermal expression is sufficient for proper inflorescence architecture. [PubMed: 22474391 Redundantly involved with EPFL4 in procambial development regulation. Acts also as tissue-specific regulator of epidermal pattern. Controls stomatal patterning by repressing stomatal production. TMM (AC Q9SSD1) functions to dampen or block CHAL signaling. Not processed by SDD1 (AC O64495 Acts as growth-regulatory ligand for ERECTA family receptors.]
Protein Sequence	MGFERTSSSLSLLSSSLPSSLQPSENTRAKFSLFYLLLLFFVLCVIATFTITPTSTSSPYNRNSNSGTLGNFYAKEEGKSTVVIKKTRKIGDRSKEAELRRILRGLGSSPPRCSSKCGRCTPCKPVHVPVPPGTPVTAEYYPEAWRCKCGNKLYMP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of EPFL6_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of EPFL6_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of EPFL6_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of EPFL6_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of EPFL6_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of EPFL6_ARATH

Related Literatures of Post-Translational Modification