dbPTM

EPF2_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	EPF2_ARATH
UniProt AC	Q8LC53
Protein Name	Protein EPIDERMAL PATTERNING FACTOR 2 {ECO:0000303\|PubMed:19435754}
Gene Name	EPF2 {ECO:0000303\|PubMed:19435754}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	120
Subcellular Localization	Secreted .
Protein Description	Controls stomatal patterning. Regulates the number of cells that enter, and remain in, the stomatal lineage by inhibiting protodermal cells from adopting the meristemoid mother cell (MMC) fate in a non-cell-autonomous manner. Mediates stomatal development inhibition. MEPF2: mobile signal controlling stomatal development in a non-cell-autonomous manner. [PubMed: 22241782 Uses ERECTA as major receptor]
Protein Sequence	MTKFVRKYMFCLVLVFAACSLVVNSIRTPPLKNTVNGGEKKNADIEQAQTHHKKEISKNGGVEMEMYPTGSSLPDCSYACGACSPCKRVMISFECSVAESCSVIYRCTCRGRYYHVPSRA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
57	Phosphorylation	THHKKEISKNGGVEM HHHHHHHHHCCCEEE	22.59	24894044
69	Phosphorylation	VEMEMYPTGSSLPDC EEEEEECCCCCCCCC	32.01	24894044
71	Phosphorylation	MEMYPTGSSLPDCSY EEEECCCCCCCCCCC	31.05	24894044
72	Phosphorylation	EMYPTGSSLPDCSYA EEECCCCCCCCCCCC	45.31	24894044
77	Phosphorylation	GSSLPDCSYACGACS CCCCCCCCCCCCCCC	24.12	24894044
84	Phosphorylation	SYACGACSPCKRVMI CCCCCCCCCCCEEEE	32.57	24894044

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of EPF2_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of EPF2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of EPF2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of EPF2_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of EPF2_ARATH

Related Literatures of Post-Translational Modification