UniProt ID | EPF1_ARATH | |
---|---|---|
UniProt AC | Q8S8I4 | |
Protein Name | Protein EPIDERMAL PATTERNING FACTOR 1 {ECO:0000303|PubMed:17639078} | |
Gene Name | EPF1 {ECO:0000303|PubMed:17639078} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 104 | |
Subcellular Localization | Secreted . | |
Protein Description | Controls stomatal patterning. Regulates asymmetric cell division during guard cell differentiation. Mediates stomatal development inhibition. Not cleaved by the protease CRSP (AC Q9LNU1). [PubMed: 25043023 MEPF1: mobile signal controlling stomatal development in a non-cell-autonomous manner] | |
Protein Sequence | MKSLLLLAFFLSFFFGSLLARHLPTSSHPSHHHVGMTGALKRQRRRPDTVQVAGSRLPDCSHACGSCSPCRLVMVSFVCASVEEAETCPMAYKCMCNNKSYPVP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
98 | N-linked_Glycosylation | AYKCMCNNKSYPVP- CEEHHCCCCCCCCC- | 29.71 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EPF1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EPF1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EPF1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of EPF1_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...