EPF1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: EPF1_ARATH
• UniProt AC: Q8S8I4
• Protein Name: Protein EPIDERMAL PATTERNING FACTOR 1 {ECO:0000303|PubMed:17639078}
• Gene Name: EPF1 {ECO:0000303|PubMed:17639078}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 104
• Subcellular Localization: Secreted .
• Protein Description: Controls stomatal patterning. Regulates asymmetric cell division during guard cell differentiation. Mediates stomatal development inhibition. Not cleaved by the protease CRSP (AC Q9LNU1). [PubMed: 25043023 MEPF1: mobile signal controlling stomatal development in a non-cell-autonomous manner]
• Protein Sequence: MKSLLLLAFFLSFFFGSLLARHLPTSSHPSHHHVGMTGALKRQRRRPDTVQVAGSRLPDCSHACGSCSPCRLVMVSFVCASVEEAETCPMAYKCMCNNKSYPVP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
98	N-linked_Glycosylation	AYKCMCNNKSYPVP- CEEHHCCCCCCCCC-	29.71	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of EPF1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of EPF1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of EPF1_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of EPF1_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.