ENY2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ENY2_MOUSE
• UniProt AC: Q9JIX0
• Protein Name: Transcription and mRNA export factor ENY2 {ECO:0000255|HAMAP-Rule:MF_03046}
• Gene Name: Eny2
• Organism: Mus musculus (Mouse).
• Sequence Length: 101
• Subcellular Localization: Nucleus, nucleoplasm . Nucleus, nuclear pore complex .
• Protein Description: Involved in mRNA export coupled transcription activation by association with both the TREX-2 and the SAGA complexes. The transcription regulatory histone acetylation (HAT) complex SAGA is a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates both histones H2A and H2B. The SAGA complex is recruited to specific gene promoters by activators such as MYC, where it is required for transcription. Required for nuclear receptor-mediated transactivation. The TREX-2 complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). TREX-2 participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery (By similarity)..
• Protein Sequence: MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQHASL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
43	Acetylation	KLIECGWKDQLKAHC HHHHCCCHHHHHHHH	22.38	22826441
74	Ubiquitination	LVAEITPKGRALVPD HHHHCCCCCCCCCCH	52.99	22790023
100	Phosphorylation	TFLAQHASL------ HHHHHHHCC------	32.27	26643407

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ENY2_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ENY2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ENY2_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of ENY2_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.