dbPTM

ENDO5_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ENDO5_ARATH
UniProt AC	F4JJL3
Protein Name	Endonuclease 5
Gene Name	ENDO5
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	296
Subcellular Localization
Protein Description	Hydrolyzes only single-stranded DNA and RNA without apparent specificity for bases. Endonuclease that recognizes and cleaves some mismatches with high efficiency, including heteroduplex double-stranded DNA; mostly efficient on T/G, A/G and G/G mismatches, less efficient for T/T and poorly efficient for C/C, A/A, T/C and A/C..
Protein Sequence	MRLWIVSVLVLTHLVHGALCWGKDGHYTVCKLAEGFFEDDTIAAVKKLLPESVDGGGLADFCSWPDEIKKLSQWQWTSTLHYVNTPEYRCNYEYCRDCHDTHKHKDWCVTGAIFNYTNQLMSASENSQNIVHYNLTEALLFLSHYMGDVHQPLHTGFLGDLGGNTIIVNWYHNKSNLHHVWDNMIIDSALETYYNSSLPHMIQALQAKLKNGWSNDVPSWKSCHFHQKACPNLYASESIDLACKYAYRNATPGTTLGDEYFLSRLPVVEKRLAQGGIRLAATLNRIFSAKPKLAGL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
115	N-linked_Glycosylation	CVTGAIFNYTNQLMS HHHHHHHHHHHHHHH	36.28	-
134	N-linked_Glycosylation	SQNIVHYNLTEALLF CCCCCCCCHHHHHHH	26.13	-
173	N-linked_Glycosylation	IIVNWYHNKSNLHHV EEEEEEECCCCCCHH	33.48	-
195	N-linked_Glycosylation	SALETYYNSSLPHMI HHHHHHHHCCHHHHH	18.08	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ENDO5_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ENDO5_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ENDO5_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of ENDO5_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ENDO5_ARATH

Related Literatures of Post-Translational Modification