UniProt ID | EMP3_HUMAN | |
---|---|---|
UniProt AC | P54852 | |
Protein Name | Epithelial membrane protein 3 | |
Gene Name | EMP3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 163 | |
Subcellular Localization |
Membrane Multi-pass membrane protein. |
|
Protein Description | Probably involved in cell proliferation and cell-cell interactions.. | |
Protein Sequence | MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSLLLLVVS ------CHHHHHHHH | 27.94 | - | |
9 | Phosphorylation | SLLLLVVSALHILIL HHHHHHHHHHHHHHH | 20.03 | - | |
23 | Phosphorylation | LILLFVATLDKSWWT HHHHHHHHHCCCCCC | 30.13 | - | |
41 | Phosphorylation | KESLNLWYDCTWNND CCEECEEEEEECCCC | 12.33 | 29083192 | |
44 | Phosphorylation | LNLWYDCTWNNDTKT ECEEEEEECCCCCCE | 28.47 | 29083192 | |
47 | N-linked_Glycosylation | WYDCTWNNDTKTWAC EEEEECCCCCCEECC | 50.30 | 17660510 | |
56 | N-linked_Glycosylation | TKTWACSNVSENGWL CCEECCCCCCCCCHH | 41.01 | UniProtKB CARBOHYD |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EMP3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EMP3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EMP3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of EMP3_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...