ELOV6_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ELOV6_HUMAN
• UniProt AC: Q9H5J4
• Protein Name: Elongation of very long chain fatty acids protein 6 {ECO:0000255|HAMAP-Rule:MF_03206, ECO:0000305}
• Gene Name: ELOVL6 {ECO:0000255|HAMAP-Rule:MF_03206}
• Organism: Homo sapiens (Human).
• Sequence Length: 265
• Subcellular Localization: Endoplasmic reticulum membrane ; Multi-pass membrane protein .
• Protein Description: Catalyzes the first and rate-limiting reaction of the four that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. Condensing enzyme that elongates fatty acids with 12, 14 and 16 carbons with higher activity toward C16:0 acyl-CoAs. Catalyzes the synthesis of unsaturated C16 long chain fatty acids and, to a lesser extent, C18:0 and those with low desaturation degree. May participate in the production of saturated and monounsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators..
• Protein Sequence: MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	N-linked_Glycosylation	------MNMSVLTLQ ------CCCCEEECE	31.28	UniProtKB CARBOHYD
7	O-linked_Glycosylation	-MNMSVLTLQEYEFE -CCCCEEECEEHHHH	25.00	29351928
31	Ubiquitination	QWMQENWKKSFLFSA HHHHHHHHHHHHHHH	50.55	21906983
109	Phosphorylation	GFYNGPVSKFWAYAF CCCCCCHHHHHHHHH	25.85	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ELOV6_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ELOV6_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ELOV6_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of ELOV6_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.