ELOV2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ELOV2_HUMAN
• UniProt AC: Q9NXB9
• Protein Name: Elongation of very long chain fatty acids protein 2 {ECO:0000255|HAMAP-Rule:MF_03202, ECO:0000305}
• Gene Name: ELOVL2 {ECO:0000255|HAMAP-Rule:MF_03202}
• Organism: Homo sapiens (Human).
• Sequence Length: 296
• Subcellular Localization: Endoplasmic reticulum membrane ; Multi-pass membrane protein .
• Protein Description: Catalyzes the first and rate-limiting reaction of the four that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. Acts specifically toward polyunsaturated acyl-CoA with the higher activity toward C20:4(n-6) acyl-CoA. Condensing enzyme that catalyzes the synthesis of polyunsaturated very long chain fatty acid (C20- and C22-PUFA). May participate in the production of polyunsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators..
• Protein Sequence: MEHLKAFDDEINAFLDNMFGPRDSRVRGWFMLDSYLPTFFLTVMYLLSIWLGNKYMKNRPALSLRGILTLYNLGITLLSAYMLAELILSTWEGGYNLQCQDLTSAGEADIRVAKVLWWYYFSKSVEFLDTIFFVLRKKTSQITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVFPSMHKYLWWKKYLTQAQLVQFVLTITHTMSAVVKPCGFPFGCLIFQSSYMLTLVILFLNFYVQTYRKKPMKKDMQEPPAGKEVKNGFSKAYFTAANGVMNKKAQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
34	Phosphorylation	RGWFMLDSYLPTFFL CCHHCCCCHHHHHHH	25.30	25693802
35	Phosphorylation	GWFMLDSYLPTFFLT CHHCCCCHHHHHHHH	19.17	25693802
38	Phosphorylation	MLDSYLPTFFLTVMY CCCCHHHHHHHHHHH	25.15	25693802
42	Phosphorylation	YLPTFFLTVMYLLSI HHHHHHHHHHHHHHH	9.70	25693802
45	Phosphorylation	TFFLTVMYLLSIWLG HHHHHHHHHHHHHHC	10.52	25693802
48	Phosphorylation	LTVMYLLSIWLGNKY HHHHHHHHHHHCCHH	14.77	25693802
55	Phosphorylation	SIWLGNKYMKNRPAL HHHHCCHHHCCCCCH	19.81	20049867
63	Phosphorylation	MKNRPALSLRGILTL HCCCCCHHHHHHHHH	20.37	24719451
293	Acetylation	AANGVMNKKAQ---- HHHCCCCCCCC----	31.24	30588479

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ELOV2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ELOV2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ELOV2_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of ELOV2_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.