dbPTM

ELOH1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ELOH1_SCHPO
UniProt AC	Q9UTF7
Protein Name	Putative elongation of fatty acids protein 1 {ECO:0000250\|UniProtKB:P40319}
Gene Name	SPAC1B2.03c {ECO:0000312\|PomBase:SPAC1B2.03c}
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	334
Subcellular Localization	Endoplasmic reticulum membrane Multi-pass membrane protein .
Protein Description	May be involved in the synthesis of very long chain fatty acids..
Protein Sequence	MDLTGAHMLKIHRPSIDHPFGVDLWHLFEQLSIKTIGWNPSEFEYIPGKTPMSQWSSVIVSITAYYVIILSGRAIMTNRKPLKQRRLFQLHNFILTIISGALLALLVEEVFRNYMRNGLFYCVCDSRHFTQRLVTLYYLNYLTKYLELMDTVFLFLKKKPLAFLHCYHHGITALLCFTQLLGRTSVQWGVIGLNLYVHVIMYSYYFLAACGRRVWWKQWVTRVQIIQFVLDLILCYFGTYSHIAFRYFPWLPHVGDCSGSLFAAFFGCGVLSSYLFLFIGFYINTYIKRGAKKNQRKAAGKADNTSVAAAAGSEALAATTATNASPFSARSRKL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
319	Phosphorylation	GSEALAATTATNASP CCHHHHHHCCCCCCC	16.03	21712547
320	Phosphorylation	SEALAATTATNASPF CHHHHHHCCCCCCCC	27.10	21712547
322	Phosphorylation	ALAATTATNASPFSA HHHHHCCCCCCCCCC	29.26	21712547
325	Phosphorylation	ATTATNASPFSARSR HHCCCCCCCCCCCCC	28.66	28889911
328	Phosphorylation	ATNASPFSARSRKL- CCCCCCCCCCCCCC-	26.59	21712547
331	Phosphorylation	ASPFSARSRKL---- CCCCCCCCCCC----	33.22	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ELOH1_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ELOH1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ELOH1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of ELOH1_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ELOH1_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-325, AND MASSSPECTROMETRY.	18257517 [Abstract]