| UniProt ID | ELOA3_HUMAN | |
|---|---|---|
| UniProt AC | Q8NG57 | |
| Protein Name | Elongin-A3 | |
| Gene Name | ELOA3 {ECO:0000312|HGNC:HGNC:24617} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 546 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A3 is transcriptionally active but its transcription activity is not enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex).. | |
| Protein Sequence | MAAGSTTLRAVGKLQVRLATKTEPKKLEKYLQKLSALPMTADILAETGIRKTVKRLRKHQHVGDFARDLAARWKKLVLVDRNTGPDPQDPEESASRQRFGEALQEREKAWGFPENATAPRSPSHSPEHRRTARRTPPGQQRPHPRSPSREPRAERKRPRMAPADSGPHRDPPTRTAPLPMPEGPEPAVPGEQPGRGHAHAAQGGPLLGQGCQGQPQGEAVGSHSKGHKSSRGASAQKSPPVQESQSERLQAAGADSAGPKTVPSHVFSELWDPSEAWMQANYDLLSAFEAMTSQANPEALSAPALQEEAAFPGRRVNAKMPVYSGSRPACQLQVPTLRQQCLRVPRNNPDALGDVEGVPYSVLEPVLEGWTPDQLYRTEKDNAALARETDELWRIHCLQDFKEEKPQEHESWRELYLRLRDAREQRLRVVTTKIRSARENKPSGRQTKMICFNSVAKTPYDASRRQEKSAGAADPGNGEMEPAPKPAGSSQAPSGLGDGDGGSVSGGGSSNRHAAPADKTRKQAAKKVAPLMAKAIRDYKGRFSRR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Phosphorylation | ---MAAGSTTLRAVG ---CCCCCHHHHHHH | 17.31 | 29083192 | |
| 6 | Phosphorylation | --MAAGSTTLRAVGK --CCCCCHHHHHHHH | 29.00 | 29083192 | |
| 7 | Phosphorylation | -MAAGSTTLRAVGKL -CCCCCHHHHHHHHH | 18.88 | 29083192 | |
| 21 | Acetylation | LQVRLATKTEPKKLE HHHEECCCCCHHHHH | 45.33 | - | |
| 26 | Methylation | ATKTEPKKLEKYLQK CCCCCHHHHHHHHHH | 73.01 | - | |
| 26 | "N6,N6-dimethyllysine" | ATKTEPKKLEKYLQK CCCCCHHHHHHHHHH | 73.01 | - | |
| 238 | Phosphorylation | RGASAQKSPPVQESQ CCCCCCCCCCCCCHH | 23.50 | - | |
| 416 | Phosphorylation | HESWRELYLRLRDAR CHHHHHHHHHHHHHH | 5.75 | 22817900 | |
| 432 | Phosphorylation | QRLRVVTTKIRSARE HHHHHHHHHHHHHHH | 16.92 | 28555341 | |
| 447 | Phosphorylation | NKPSGRQTKMICFNS CCCCCCCCEEEEEHH | 22.63 | 22817900 | |
| 469 | Phosphorylation | ASRRQEKSAGAADPG HHHHHHHHCCCCCCC | 31.05 | 25954137 | |
| 489 | Phosphorylation | PAPKPAGSSQAPSGL CCCCCCCCCCCCCCC | 22.76 | 25954137 | |
| 490 | Phosphorylation | APKPAGSSQAPSGLG CCCCCCCCCCCCCCC | 29.46 | 25954137 | |
| 503 | Phosphorylation | LGDGDGGSVSGGGSS CCCCCCCCCCCCCCC | 20.74 | 25954137 | |
| 505 | Phosphorylation | DGDGGSVSGGGSSNR CCCCCCCCCCCCCCC | 33.16 | 25954137 | |
| 509 | Phosphorylation | GSVSGGGSSNRHAAP CCCCCCCCCCCCCCC | 27.93 | 22210691 | |
| 510 | Phosphorylation | SVSGGGSSNRHAAPA CCCCCCCCCCCCCCC | 40.95 | 25954137 | |
| 520 | Phosphorylation | HAAPADKTRKQAAKK CCCCCHHHHHHHHHH | 43.58 | 22210691 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ELOA3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ELOA3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ELOA3_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ELOB_HUMAN | TCEB2 | physical | 11994304 | |
| ELOC_HUMAN | TCEB1 | physical | 11994304 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...