UniProt ID | ELMD1_MOUSE | |
---|---|---|
UniProt AC | Q3V1U8 | |
Protein Name | ELMO domain-containing protein 1 | |
Gene Name | Elmod1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 326 | |
Subcellular Localization | ||
Protein Description | Acts as a GTPase-activating protein (GAP) toward guanine nucleotide exchange factors like ARL2, ARL3, ARF1 and ARF6, but not for GTPases outside the Arf family.. | |
Protein Sequence | MKHFLRMLIQVCLYFYCKFLWRCMKFVMRKLTGRCELQRICYGTKPGASRTMKIETSLRDSKSKLLQTSVSVHPDAIEKTIDDIMELKKINPDINPQLGISLQACLLQIVGYRNLIADVEKLRREPYDSDNPQHEEMLLKLWELLKPNTPLESRVSKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFAERDATVAQQVLSDSVHPKCSKFSKIEWEKKKMDKAIGYSFAIVGINITDLAYNLLVSGALKTHFYNIAPEAPTLSHFQQTFCYLMHEFHKFWIEEDPMDIMEFNRVREKFRKRIIKQLQNPDMALCPHFAASEGLINM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
45 | Ubiquitination | QRICYGTKPGASRTM EHHHCCCCCCCCCEE | 36.77 | - | |
129 | Phosphorylation | LRREPYDSDNPQHEE HHCCCCCCCCHHHHH | 33.18 | 27742792 | |
212 | Ubiquitination | PKCSKFSKIEWEKKK CCCCCCCCCHHHHHH | 48.02 | - | |
217 | Ubiquitination | FSKIEWEKKKMDKAI CCCCHHHHHHHHHHH | 59.78 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ELMD1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ELMD1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ELMD1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ELMD1_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...