UniProt ID | EIF3K_MOUSE | |
---|---|---|
UniProt AC | Q9DBZ5 | |
Protein Name | Eukaryotic translation initiation factor 3 subunit K {ECO:0000255|HAMAP-Rule:MF_03010} | |
Gene Name | Eif3k | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 218 | |
Subcellular Localization | Nucleus . Cytoplasm . | |
Protein Description | Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression.. | |
Protein Sequence | MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLTDNQLKVWMSKYGWSADESGQVFICSQEESIKPKNIVEKIDFDSVSSIMASSQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAMFEQMRA ------CHHHHHHHH | 16.04 | - | |
13 | Acetylation | QMRANVGKLLKGIDR HHHHHHHHHHHCHHH | 46.49 | - | |
13 | Malonylation | QMRANVGKLLKGIDR HHHHHHHHHHHCHHH | 46.49 | 26320211 | |
28 | Phosphorylation | YNPENLATLERYVET CCHHHHHHHHHHHHH | 32.11 | - | |
190 | Glutathionylation | ESGQVFICSQEESIK CCCCEEECCCCCCCC | 2.03 | 24333276 | |
204 | Ubiquitination | KPKNIVEKIDFDSVS CCCCHHHCCCHHHHH | 36.36 | - | |
209 | Phosphorylation | VEKIDFDSVSSIMAS HHCCCHHHHHHHHHC | 24.72 | 25619855 | |
211 | Phosphorylation | KIDFDSVSSIMASSQ CCCHHHHHHHHHCCC | 20.35 | 25619855 | |
212 | Phosphorylation | IDFDSVSSIMASSQ- CCHHHHHHHHHCCC- | 17.77 | 25619855 | |
216 | Phosphorylation | SVSSIMASSQ----- HHHHHHHCCC----- | 16.34 | 25619855 | |
217 | Phosphorylation | VSSIMASSQ------ HHHHHHCCC------ | 30.30 | 27087446 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EIF3K_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EIF3K_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EIF3K_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of EIF3K_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...