UniProt ID | EI3JA_MOUSE | |
---|---|---|
UniProt AC | Q3UGC7 | |
Protein Name | Eukaryotic translation initiation factor 3 subunit J-A {ECO:0000255|HAMAP-Rule:MF_03009} | |
Gene Name | Eif3j1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 261 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression. This subunit binds directly within the mRNA entry channel of the 40S ribosome to the aminoacyl (A) site. It may regulate the interaction between the 43S PIC and mRNA.. | |
Protein Sequence | MAAAAAAAAAAGDSDSWDADTFSMEDPVRKVAGGGTAGGDRWEGEDEDEDVKDNWDDDDDENKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEESKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNTVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEALVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYEGGYVQDYEDFM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
14 | Phosphorylation | AAAAAGDSDSWDADT HHHHHCCCCCCCCCC | 26824392 | ||
16 | Phosphorylation | AAAGDSDSWDADTFS HHHCCCCCCCCCCCC | 26824392 | ||
21 | Phosphorylation | SDSWDADTFSMEDPV CCCCCCCCCCCCCCC | 23684622 | ||
23 | Phosphorylation | SWDADTFSMEDPVRK CCCCCCCCCCCCCHH | 23684622 | ||
108 | Phosphorylation | RLEEPEESKVLTPEE HHCCHHHHCCCCHHH | 29514104 | ||
112 | Phosphorylation | PEESKVLTPEEQLAD HHHHCCCCHHHHHHH | 25521595 | ||
120 | Ubiquitination | PEEQLADKLRLKKLQ HHHHHHHHHHHHHHH | - | ||
120 | Malonylation | PEEQLADKLRLKKLQ HHHHHHHHHHHHHHH | 26320211 | ||
120 | Acetylation | PEEQLADKLRLKKLQ HHHHHHHHHHHHHHH | 23806337 | ||
130 | Phosphorylation | LKKLQEESDLELAKE HHHHHHHHCHHHHHH | 25521595 | ||
164 | Ubiquitination | DDFTEFGKLLKDKIT CCHHHHHHHHHHHHH | - | ||
169 | Ubiquitination | FGKLLKDKITQYEKS HHHHHHHHHHHHHHH | 27667366 | ||
201 | Acetylation | LEIDDLKKITNSLTV CCHHHHHHHHHHHHH | 22826441 | ||
211 | Phosphorylation | NSLTVLCSEKQKQEK HHHHHHCCHHHHHHH | - | ||
227 | Malonylation | SKAKKKKKGVVPGGG HHHHHHCCCCCCCCC | 26320211 | ||
238 | Phosphorylation | PGGGLKATMKDDLAD CCCCHHHHHCCHHHH | 20531401 | ||
246 | Phosphorylation | MKDDLADYGGYEGGY HCCHHHHCCCCCCCC | 22817900 | ||
257 | Phosphorylation | EGGYVQDYEDFM--- CCCCCCCHHHHC--- | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EI3JA_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EI3JA_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EI3JA_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of EI3JA_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...