dbPTM

EI3F2_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	EI3F2_DROME
UniProt AC	A1Z6K7
Protein Name	Eukaryotic translation initiation factor 3 subunit F-2 {ECO:0000255\|HAMAP-Rule:MF_03005}
Gene Name	eIF3f2 {ECO:0000255\|HAMAP-Rule:MF_03005}
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	285
Subcellular Localization	Cytoplasm .
Protein Description	Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation..
Protein Sequence	MSRNFSMRAKVYLKPLVFFQIIDAYDRRPKGDNQVMGTLLGRNKEGHIEITNCFTVPHKEHSENKRIDLDMAYASEVLELNMFAYPNERVLGWFCTGKSVSRSASLIHDYYVRECCEGQPLHLLVDAALKNQRLSTRLYCAVEMGVPGGTKGLMFSLVPLEISNENSDLVALRCIEKQSQQQASKQMERFVPELAQVVDATRDMQHRLDLVLRYINDVLARKKKPDNVVGRSLYAALTAVPLLDSDKFRVMFNTNLRDMLMAITLSTMIKTQLEISEKLSCMQDQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of EI3F2_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of EI3F2_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of EI3F2_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of EI3F2_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of EI3F2_DROME !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of EI3F2_DROME

Related Literatures of Post-Translational Modification