| UniProt ID | EI2BA_MOUSE | |
|---|---|---|
| UniProt AC | Q99LC8 | |
| Protein Name | Translation initiation factor eIF-2B subunit alpha | |
| Gene Name | Eif2b1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 305 | |
| Subcellular Localization | ||
| Protein Description | Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.. | |
| Protein Sequence | MEDGELIEYFKSQMKGDPKMASAVAAIQTLLEFLKRDKGETLQGLRANLTYAIKTLCGVDSSVAVSSGGELFLRFISLTSLEYSDYSKCKKIMIERGELFLRRISLSRNKIANLCHTFIKDGARILTHAYSRVVLRVLEEAVAAKKRFSVYITESQPDLSGKKMAKALSHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQEDVPDKFKYKADTLKSVQTGQDLKEEHPWVDYTSPSLITLLFTDLGVLTPSAVSDELIKLYL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 35 | Acetylation | QTLLEFLKRDKGETL HHHHHHHHHCCCCCH | 64.96 | - | |
| 50 | Phosphorylation | QGLRANLTYAIKTLC HHHHHHHHHHHHHHH | 15.66 | 27180971 | |
| 51 | Phosphorylation | GLRANLTYAIKTLCG HHHHHHHHHHHHHHC | 14.97 | 27180971 | |
| 105 | Phosphorylation | ELFLRRISLSRNKIA HHHHHHHHCCCCHHH | 20.62 | 19854140 | |
| 107 | Phosphorylation | FLRRISLSRNKIANL HHHHHHCCCCHHHHH | 27.32 | 22982522 | |
| 120 | Acetylation | NLCHTFIKDGARILT HHHHHHHHCHHHHHH | 46.01 | 22826441 | |
| 151 | Phosphorylation | AKKRFSVYITESQPD HHCCEEEEEECCCCC | 10.83 | 25177544 | |
| 153 | Phosphorylation | KRFSVYITESQPDLS CCEEEEEECCCCCCC | 16.34 | 25177544 | |
| 218 | Glutathionylation | GTNQMAVCAKAQNKP CCCCHHHHHHCCCCC | 2.03 | 24333276 | |
| 258 | Ubiquitination | KYKADTLKSVQTGQD CCCHHHHHHCCCCCC | 51.15 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EI2BA_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EI2BA_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EI2BA_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of EI2BA_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...