UniProt ID | EGFL7_MOUSE | |
---|---|---|
UniProt AC | Q9QXT5 | |
Protein Name | Epidermal growth factor-like protein 7 | |
Gene Name | Egfl7 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 275 | |
Subcellular Localization | Secreted, extracellular space . | |
Protein Description | Regulates vascular tubulogenesis in vivo. Inhibits platelet-derived growth factor (PDGF)-BB-induced smooth muscle cell migration and promotes endothelial cell adhesion to the extracellular matrix and angiogenesis.. | |
Protein Sequence | MWGSGELLVAWFLVLAADGTTEHVYRPSRRVCTVGISGGSISETFVQRVYQPYLTTCDGHRACSTYRTIYRTAYRRSPGVTPARPRYACCPGWKRTSGLPGACGAAICQPPCGNGGSCIRPGHCRCPVGWQGDTCQTDVDECSTGEASCPQRCVNTVGSYWCQGWEGQSPSADGTRCLSKEGPSPVAPNPTAGVDSMAREEVYRLQARVDVLEQKLQLVLAPLHSLASRSTEHGLQDPGSLLAHSFQQLDRIDSLSEQVSFLEEHLGSCSCKKDL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
28 | Phosphorylation | TEHVYRPSRRVCTVG CCCCCCCCCCEEEEE | 24.58 | 20415495 | |
33 | Phosphorylation | RPSRRVCTVGISGGS CCCCCEEEEEECCCC | 20.93 | 20415495 | |
42 | Phosphorylation | GISGGSISETFVQRV EECCCCHHHHHHHHH | 32.08 | 20415495 | |
44 | Phosphorylation | SGGSISETFVQRVYQ CCCCHHHHHHHHHHC | 23.47 | 20415495 | |
203 | Phosphorylation | SMAREEVYRLQARVD HHHHHHHHHHHHHHH | 14.64 | 23140645 | |
225 | Phosphorylation | LVLAPLHSLASRSTE HHHHHHHHHHHCCHH | 33.06 | 27841257 | |
228 | Phosphorylation | APLHSLASRSTEHGL HHHHHHHHCCHHCCC | 31.86 | 27841257 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EGFL7_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EGFL7_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EGFL7_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of EGFL7_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...