dbPTM

EGFL7_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	EGFL7_MOUSE
UniProt AC	Q9QXT5
Protein Name	Epidermal growth factor-like protein 7
Gene Name	Egfl7
Organism	Mus musculus (Mouse).
Sequence Length	275
Subcellular Localization	Secreted, extracellular space .
Protein Description	Regulates vascular tubulogenesis in vivo. Inhibits platelet-derived growth factor (PDGF)-BB-induced smooth muscle cell migration and promotes endothelial cell adhesion to the extracellular matrix and angiogenesis..
Protein Sequence	MWGSGELLVAWFLVLAADGTTEHVYRPSRRVCTVGISGGSISETFVQRVYQPYLTTCDGHRACSTYRTIYRTAYRRSPGVTPARPRYACCPGWKRTSGLPGACGAAICQPPCGNGGSCIRPGHCRCPVGWQGDTCQTDVDECSTGEASCPQRCVNTVGSYWCQGWEGQSPSADGTRCLSKEGPSPVAPNPTAGVDSMAREEVYRLQARVDVLEQKLQLVLAPLHSLASRSTEHGLQDPGSLLAHSFQQLDRIDSLSEQVSFLEEHLGSCSCKKDL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
28	Phosphorylation	TEHVYRPSRRVCTVG CCCCCCCCCCEEEEE	24.58	20415495
33	Phosphorylation	RPSRRVCTVGISGGS CCCCCEEEEEECCCC	20.93	20415495
42	Phosphorylation	GISGGSISETFVQRV EECCCCHHHHHHHHH	32.08	20415495
44	Phosphorylation	SGGSISETFVQRVYQ CCCCHHHHHHHHHHC	23.47	20415495
203	Phosphorylation	SMAREEVYRLQARVD HHHHHHHHHHHHHHH	14.64	23140645
225	Phosphorylation	LVLAPLHSLASRSTE HHHHHHHHHHHCCHH	33.06	27841257
228	Phosphorylation	APLHSLASRSTEHGL HHHHHHHHCCHHCCC	31.86	27841257

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of EGFL7_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of EGFL7_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of EGFL7_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of EGFL7_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of EGFL7_MOUSE

Related Literatures of Post-Translational Modification