UniProt ID | EFTS_CAEEL | |
---|---|---|
UniProt AC | Q20819 | |
Protein Name | Elongation factor Ts, mitochondrial {ECO:0000255|HAMAP-Rule:MF_03135} | |
Gene Name | tsfm-1 {ECO:0000255|HAMAP-Rule:MF_03135} | |
Organism | Caenorhabditis elegans. | |
Sequence Length | 316 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | Associates with the EF-Tu.GDP complex and induces the exchange of GDP to GTP. It remains bound to the aminoacyl-tRNA.EF-Tu.GTP complex up to the GTP hydrolysis stage on the ribosome.. | |
Protein Sequence | MFARAPFVRLLSTTSRNLAEAEKKVSKEALMALRKKTGYSYVNCRKALIQFGENDMDSAVKWLKEAAAKEGWAKAAKLGTRVTSNGLVSVVTDNSTAAVVELSCETDFVARSGAFKDLLSNISNSVLAKAKPQSISSGSKLQEFTYDLGDLTDSDGKNMREVLSLSIGKLGENMTVRRVKAFKAPEGTTLFGASHPKDGTDDIPMGRFISLIALNQSSPGSISSQQLAGQICQHIIGMSPESLGEAAESVKTQEGLRSQEGHDPNADPVVVTNIDESETALLRQAFMLNPSQSVHEYLKSHNANILDFVRVELGSE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of EFTS_CAEEL !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EFTS_CAEEL !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EFTS_CAEEL !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EFTS_CAEEL !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of EFTS_CAEEL !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...