UniProt ID | EFNA4_HUMAN | |
---|---|---|
UniProt AC | P52798 | |
Protein Name | Ephrin-A4 | |
Gene Name | EFNA4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 201 | |
Subcellular Localization |
Isoform 1: Cell membrane Lipid-anchor, GPI-anchor. Isoform 2: Secreted . |
|
Protein Description | Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. May play a role in the interaction between activated B-lymphocytes and dendritic cells in tonsils.. | |
Protein Sequence | MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESGTSGWRGGDTPSPLCLLLLLLLLILRLLRIL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
33 | N-linked_Glycosylation | LRHVVYWNSSNPRLL CCEEEEECCCCCCCC | 20.20 | UniProtKB CARBOHYD | |
111 | Ubiquitination | GHVQFSEKIQRFTPF CCEEHHHHHHHHCCE | 42.83 | - | |
154 | Ubiquitination | LQVSVCCKERKSESA EEEEEEECCCCCCCC | 56.26 | - | |
158 | Phosphorylation | VCCKERKSESAHPVG EEECCCCCCCCCCCC | 42.90 | - | |
160 | Phosphorylation | CKERKSESAHPVGSP ECCCCCCCCCCCCCC | 38.68 | - | |
166 | Phosphorylation | ESAHPVGSPGESGTS CCCCCCCCCCCCCCC | 29.93 | - | |
170 | Phosphorylation | PVGSPGESGTSGWRG CCCCCCCCCCCCCCC | 53.97 | 24425749 | |
170 | GPI-anchor | PVGSPGESGTSGWRG CCCCCCCCCCCCCCC | 53.97 | - | |
173 | Phosphorylation | SPGESGTSGWRGGDT CCCCCCCCCCCCCCC | 39.62 | 24425749 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EFNA4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EFNA4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EFNA4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of EFNA4_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...