UniProt ID | EFMT1_HUMAN | |
---|---|---|
UniProt AC | Q8WVE0 | |
Protein Name | EEF1A lysine methyltransferase 1 {ECO:0000255|HAMAP-Rule:MF_03187, ECO:0000312|HGNC:HGNC:27351} | |
Gene Name | EEF1AKMT1 {ECO:0000255|HAMAP-Rule:MF_03187, ECO:0000312|HGNC:HGNC:27351} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 214 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Protein-lysine methyltransferase that selectively catalyzes the trimethylation of EEF1A at 'Lys-79'.. | |
Protein Sequence | MSDLEDDETPQLSAHALAALQEFYAEQKQQIEPGEDDKYNIGIIEENWQLSQFWYSQETALQLAQEAIAAVGEGGRIACVSAPSVYQKLRELCRENFSIYIFEYDKRFAMYGEEFIFYDYNNPLDLPERIAAHSFDIVIADPPYLSEECLRKTSETVKYLTRGKILLCTGAIMEEQAAELLGVKMCTFVPRHTRNLANEFRCYVNYDSGLDCGI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSDLEDDET ------CCCCCCCCC | 19413330 | ||
2 | Phosphorylation | ------MSDLEDDET ------CCCCCCCCC | 26055452 | ||
9 | Phosphorylation | SDLEDDETPQLSAHA CCCCCCCCHHHHHHH | 26074081 | ||
13 | Phosphorylation | DDETPQLSAHALAAL CCCCHHHHHHHHHHH | 26074081 | ||
24 | Phosphorylation | LAALQEFYAEQKQQI HHHHHHHHHHHHHHC | 26074081 | ||
88 | Ubiquitination | SAPSVYQKLRELCRE CCHHHHHHHHHHHHH | - | ||
100 | Phosphorylation | CRENFSIYIFEYDKR HHHCCEEEEEEECHH | - | ||
158 | Ubiquitination | RKTSETVKYLTRGKI HCCHHHHHHHHHCCE | - | ||
159 | Phosphorylation | KTSETVKYLTRGKIL CCHHHHHHHHHCCEE | 24719451 | ||
161 | Phosphorylation | SETVKYLTRGKILLC HHHHHHHHHCCEEEE | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EFMT1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EFMT1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EFMT1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
EF1A2_HUMAN | EEF1A2 | physical | 28514442 | |
TTL12_HUMAN | TTLL12 | physical | 28514442 | |
EF1A1_HUMAN | EEF1A1 | physical | 28514442 | |
NFS1_HUMAN | NFS1 | physical | 28514442 | |
EGLN1_HUMAN | EGLN1 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...