UniProt ID | EFHD2_RAT | |
---|---|---|
UniProt AC | Q4FZY0 | |
Protein Name | EF-hand domain-containing protein D2 | |
Gene Name | Efhd2 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 239 | |
Subcellular Localization | Membrane raft. In a mouse immature B-cell line WEHI-231.. | |
Protein Description | May regulate B-cell receptor (BCR)-induced immature and primary B-cell apoptosis. Plays a role as negative regulator of the canonical NF-kappa-B-activating branch. Controls spontaneous apoptosis through the regulation of BCL2L1 abundance.. | |
Protein Sequence | MATDELASKLSRRLQMEDEGGEATEQPGLNGAAAAAAEAPDETAQALGSADDELSAKLLRRADLNQGIGEPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKQYDAGKDGFIDLMELKLMMEKLGAPQTHLGLKSMIQEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLHVLARLSEIDVSTEGVKGAKNFFEAKVQAINVSSRFEEEIKAEQEERKKQAEEVKQRKAAFKELQSTFK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MATDELASK ------CCHHHHHHH | 24.61 | - | |
9 | Acetylation | ATDELASKLSRRLQM CHHHHHHHHHHHHHC | 44.89 | 22902405 | |
11 | Phosphorylation | DELASKLSRRLQMED HHHHHHHHHHHHCCC | 21.06 | - | |
61 | Methylation | LSAKLLRRADLNQGI HHHHHHHHCCCCCCC | 32.21 | - | |
73 | Phosphorylation | QGIGEPQSPSRRVFN CCCCCCCCCCCCCCC | 35.24 | 28689409 | |
75 | Phosphorylation | IGEPQSPSRRVFNPY CCCCCCCCCCCCCCC | 37.66 | 27097102 | |
82 | Phosphorylation | SRRVFNPYTEFKEFS CCCCCCCCHHHHHHH | 21.72 | 30181290 | |
83 | Phosphorylation | RRVFNPYTEFKEFSR CCCCCCCHHHHHHHH | 35.88 | 30181290 | |
91 | Acetylation | EFKEFSRKQIKDMEK HHHHHHHHHHHHHHH | 56.00 | 22902405 | |
94 | Acetylation | EFSRKQIKDMEKMFK HHHHHHHHHHHHHHH | 48.83 | 22902405 | |
98 | Acetylation | KQIKDMEKMFKQYDA HHHHHHHHHHHHHHC | 42.89 | 22902405 | |
101 | Acetylation | KDMEKMFKQYDAGKD HHHHHHHHHHHCCCC | 44.44 | 22902405 | |
107 | Acetylation | FKQYDAGKDGFIDLM HHHHHCCCCCHHHHH | 57.30 | 22902405 | |
122 | Acetylation | ELKLMMEKLGAPQTH HHHHHHHHHCCCCCH | 34.03 | 22902405 | |
158 | Ubiquitination | EFLLIFRKAAAGELQ HHHHHHHHHHCCCCC | 31.46 | - | |
203 | Phosphorylation | KVQAINVSSRFEEEI HHHHHCCCHHHHHHH | 16.00 | 27097102 | |
204 | Phosphorylation | VQAINVSSRFEEEIK HHHHCCCHHHHHHHH | 36.38 | 27097102 | |
232 | Acetylation | KQRKAAFKELQSTFK HHHHHHHHHHHHHCC | 53.43 | 22902405 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
73 | S | Phosphorylation | Kinase | CDK1 | P06493 | PSP |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EFHD2_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EFHD2_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of EFHD2_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...