| UniProt ID | EF4L3_ARATH | |
|---|---|---|
| UniProt AC | Q8S8F5 | |
| Protein Name | Protein ELF4-LIKE 3 | |
| Gene Name | EFL3 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 109 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Component of the central CCA1/LHY-TOC1 feedback loop in the circadian clock that promotes clock accuracy and is required for sustained rhythms in the absence of daily light/dark cycles.. | |
| Protein Sequence | MEGDTISRMMGSGVQMDGKILQTFEKSFVQVQNILDHNRLLINEINQNHESKIPDNLGRNVGLIRELNNNVRRVAHLYVDLSNNFSKSMEASSEGDSSEGRGNRRIRPA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of EF4L3_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EF4L3_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EF4L3_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EF4L3_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of EF4L3_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...