UniProt ID | EF4L2_ARATH | |
---|---|---|
UniProt AC | Q94BS8 | |
Protein Name | Protein ELF4-LIKE 2 | |
Gene Name | EFL2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 119 | |
Subcellular Localization | Nucleus. | |
Protein Description | Component of the central CCA1/LHY-TOC1 feedback loop in the circadian clock that promotes clock accuracy and is required for sustained rhythms in the absence of daily light/dark cycles.. | |
Protein Sequence | MESRMEGDVYSGFGERYQMDGKLLQNFQKSFVQVQDILDQNRLLINEINQNHESKQADHLGRNVGLIRELNNNIRTVASLYGDLSHSFARSVDASSEGESTGTLKSDGKANNQKRFRSG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
85 | Phosphorylation | ASLYGDLSHSFARSV HHHHHHHHHHHHHCC | 23.09 | 30407730 | |
87 | Phosphorylation | LYGDLSHSFARSVDA HHHHHHHHHHHCCCC | 19.75 | 30407730 | |
91 | Phosphorylation | LSHSFARSVDASSEG HHHHHHHCCCCCCCC | 22.40 | 30407730 | |
95 | Phosphorylation | FARSVDASSEGESTG HHHCCCCCCCCCCCC | 25.18 | 30407730 | |
96 | Phosphorylation | ARSVDASSEGESTGT HHCCCCCCCCCCCCC | 51.87 | 19880383 | |
100 | Phosphorylation | DASSEGESTGTLKSD CCCCCCCCCCCCCCC | 42.89 | 30407730 | |
101 | Phosphorylation | ASSEGESTGTLKSDG CCCCCCCCCCCCCCC | 29.86 | 30407730 | |
103 | Phosphorylation | SEGESTGTLKSDGKA CCCCCCCCCCCCCCC | 30.97 | 30407730 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EF4L2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EF4L2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EF4L2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...