EF4L2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: EF4L2_ARATH
• UniProt AC: Q94BS8
• Protein Name: Protein ELF4-LIKE 2
• Gene Name: EFL2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 119
• Subcellular Localization: Nucleus.
• Protein Description: Component of the central CCA1/LHY-TOC1 feedback loop in the circadian clock that promotes clock accuracy and is required for sustained rhythms in the absence of daily light/dark cycles..
• Protein Sequence: MESRMEGDVYSGFGERYQMDGKLLQNFQKSFVQVQDILDQNRLLINEINQNHESKQADHLGRNVGLIRELNNNIRTVASLYGDLSHSFARSVDASSEGESTGTLKSDGKANNQKRFRSG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
85	Phosphorylation	ASLYGDLSHSFARSV HHHHHHHHHHHHHCC	23.09	30407730
87	Phosphorylation	LYGDLSHSFARSVDA HHHHHHHHHHHCCCC	19.75	30407730
91	Phosphorylation	LSHSFARSVDASSEG HHHHHHHCCCCCCCC	22.40	30407730
95	Phosphorylation	FARSVDASSEGESTG HHHCCCCCCCCCCCC	25.18	30407730
96	Phosphorylation	ARSVDASSEGESTGT HHCCCCCCCCCCCCC	51.87	19880383
100	Phosphorylation	DASSEGESTGTLKSD CCCCCCCCCCCCCCC	42.89	30407730
101	Phosphorylation	ASSEGESTGTLKSDG CCCCCCCCCCCCCCC	29.86	30407730
103	Phosphorylation	SEGESTGTLKSDGKA CCCCCCCCCCCCCCC	30.97	30407730

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of EF4L2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of EF4L2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of EF4L2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.