UniProt ID | EF1G_CAEEL | |
---|---|---|
UniProt AC | P54412 | |
Protein Name | Probable elongation factor 1-gamma | |
Gene Name | eef-1G {ECO:0000312|WormBase:F17C11.9a} | |
Organism | Caenorhabditis elegans. | |
Sequence Length | 398 | |
Subcellular Localization | ||
Protein Description | Probably plays a role in anchoring the complex to other cellular components.. | |
Protein Sequence | MTGKLYGNKDNFRTQKVLIAAKLANKTVTLAGDAAPADKFPLGVTPAFEGDALLFGAESIGLHLTGTSANAETVQWLQFAEGYLLPAVLGYVLPSVSAANFDKKTVEQYKNELNGQLQVLDRVLVKKTYLVGERLSLADVSVALDLLPAFQYVLDANARKSIVNVTRWFRTVVNQPAVKEVLGEVSLASSVAQFNQAKFTELSAKVAKSAPKAEKPKKEAKPAAAAAQPEDDEPKEEKSKDPFQDMPKGTFVLDNFKRSYSNEDTATKAIPHFWENFDADNWSIWKCEYKYPEDLTLAFMSCNLINGMYQRLEKLKKNAFASMILFGTDNNSTISGIWVWKGDKLAFELSPDWQVDYESYTWTKLDAKSDATKKEVNEYLMWEGDFGGKKFNQGKIFK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
161 | Phosphorylation | LDANARKSIVNVTRW HCCCCCHHHHHHHHH | 26.64 | 28854356 | |
259 | Phosphorylation | VLDNFKRSYSNEDTA EECCCCCCCCCCCCC | 33.24 | 30078680 | |
260 | Phosphorylation | LDNFKRSYSNEDTAT ECCCCCCCCCCCCCH | 21.39 | 30078680 | |
261 | Phosphorylation | DNFKRSYSNEDTATK CCCCCCCCCCCCCHH | 34.68 | 30078680 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EF1G_CAEEL !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EF1G_CAEEL !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EF1G_CAEEL !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...