EF1G_CAEEL - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: EF1G_CAEEL
• UniProt AC: P54412
• Protein Name: Probable elongation factor 1-gamma
• Gene Name: eef-1G {ECO:0000312|WormBase:F17C11.9a}
• Organism: Caenorhabditis elegans.
• Sequence Length: 398
• Protein Description: Probably plays a role in anchoring the complex to other cellular components..
• Protein Sequence: MTGKLYGNKDNFRTQKVLIAAKLANKTVTLAGDAAPADKFPLGVTPAFEGDALLFGAESIGLHLTGTSANAETVQWLQFAEGYLLPAVLGYVLPSVSAANFDKKTVEQYKNELNGQLQVLDRVLVKKTYLVGERLSLADVSVALDLLPAFQYVLDANARKSIVNVTRWFRTVVNQPAVKEVLGEVSLASSVAQFNQAKFTELSAKVAKSAPKAEKPKKEAKPAAAAAQPEDDEPKEEKSKDPFQDMPKGTFVLDNFKRSYSNEDTATKAIPHFWENFDADNWSIWKCEYKYPEDLTLAFMSCNLINGMYQRLEKLKKNAFASMILFGTDNNSTISGIWVWKGDKLAFELSPDWQVDYESYTWTKLDAKSDATKKEVNEYLMWEGDFGGKKFNQGKIFK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
161	Phosphorylation	LDANARKSIVNVTRW HCCCCCHHHHHHHHH	26.64	28854356
259	Phosphorylation	VLDNFKRSYSNEDTA EECCCCCCCCCCCCC	33.24	30078680
260	Phosphorylation	LDNFKRSYSNEDTAT ECCCCCCCCCCCCCH	21.39	30078680
261	Phosphorylation	DNFKRSYSNEDTATK CCCCCCCCCCCCCHH	34.68	30078680

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of EF1G_CAEEL !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of EF1G_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of EF1G_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.