ECM1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ECM1_SCHPO
• UniProt AC: Q9UUA0
• Protein Name: Shuttling pre-60S factor C23B6.02c
• Gene Name: SPCC23B6.02c
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 111
• Subcellular Localization: Nucleus, nucleolus. Nucleus. Cytoplasm. Shuttles between the nucleus and the cytoplasm..
• Protein Description: Pre-ribosomal factor involved in 60S ribosomal protein subunit export from the nucleus..
• Protein Sequence: MAKKQSIRSRNFRRSDPAYDLDSSTAIENETKLSVKEKVAKEIANIALRSGGSESNGISKKKKNKKQTSKKAKDKLAAALKAQAREERLDTKISKSLQKQEKLKARKQGDE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
15	Phosphorylation	RSRNFRRSDPAYDLD HHCCCCCCCCCCCCC	43.63	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ECM1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ECM1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ECM1_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of ECM1_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.