| UniProt ID | EBP_MOUSE | |
|---|---|---|
| UniProt AC | P70245 | |
| Protein Name | 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase | |
| Gene Name | Ebp | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 230 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . Nucleus envelope . Cytoplasmic vesicle . During interphase, detected on the endoplasmic reticulum and the nuclear envelope. During mitosis, detected on cytoplasmic vesicles. |
|
| Protein Description | Catalyzes the conversion of Delta(8)-sterols to their corresponding Delta(7)-isomers.. | |
| Protein Sequence | MTTNTVPLHPYWPRHLKLDNFVPNDLPTSHILVGLFSISGGLIVITWLLSSRASVVPLGAGRRLALCWFAVCTFIHLVIEGWFSLYNGILLEDQAFLSQLWKEYSKGDSRYILSDSFVVCMETVTACLWGPLSLWVVIAFLRQQPFRFVLQLVVSMGQIYGDVLYFLTELHEGLQHGEIGHPVYFWFYFVFLNAVWLVIPSILVLDAIKHLTSAQSVLDSKVMKIKSKHN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MTTNTVPLH ------CCCCCCCCC | 28.84 | - | |
| 2 | O-linked_Glycosylation | ------MTTNTVPLH ------CCCCCCCCC | 28.84 | 21606357 | |
| 155 | Phosphorylation | FVLQLVVSMGQIYGD HHHHHHHHCHHHHHH | 15.09 | - | |
| 160 | Phosphorylation | VVSMGQIYGDVLYFL HHHCHHHHHHHHHHH | 10.21 | - | |
| 216 | Phosphorylation | KHLTSAQSVLDSKVM HHHHCHHHHHHHHHH | 25.10 | 29472430 | |
| 220 | Phosphorylation | SAQSVLDSKVMKIKS CHHHHHHHHHHHHHC | 24.00 | 29472430 | |
| 221 | Ubiquitination | AQSVLDSKVMKIKSK HHHHHHHHHHHHHCC | 46.12 | - | |
| 221 | Malonylation | AQSVLDSKVMKIKSK HHHHHHHHHHHHHCC | 46.12 | 26320211 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EBP_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EBP_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EBP_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of EBP_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
