UniProt ID | EBP_MOUSE | |
---|---|---|
UniProt AC | P70245 | |
Protein Name | 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase | |
Gene Name | Ebp | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 230 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . Nucleus envelope . Cytoplasmic vesicle . During interphase, detected on the endoplasmic reticulum and the nuclear envelope. During mitosis, detected on cytoplasmic vesicles. |
|
Protein Description | Catalyzes the conversion of Delta(8)-sterols to their corresponding Delta(7)-isomers.. | |
Protein Sequence | MTTNTVPLHPYWPRHLKLDNFVPNDLPTSHILVGLFSISGGLIVITWLLSSRASVVPLGAGRRLALCWFAVCTFIHLVIEGWFSLYNGILLEDQAFLSQLWKEYSKGDSRYILSDSFVVCMETVTACLWGPLSLWVVIAFLRQQPFRFVLQLVVSMGQIYGDVLYFLTELHEGLQHGEIGHPVYFWFYFVFLNAVWLVIPSILVLDAIKHLTSAQSVLDSKVMKIKSKHN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MTTNTVPLH ------CCCCCCCCC | 28.84 | - | |
2 | O-linked_Glycosylation | ------MTTNTVPLH ------CCCCCCCCC | 28.84 | 21606357 | |
155 | Phosphorylation | FVLQLVVSMGQIYGD HHHHHHHHCHHHHHH | 15.09 | - | |
160 | Phosphorylation | VVSMGQIYGDVLYFL HHHCHHHHHHHHHHH | 10.21 | - | |
216 | Phosphorylation | KHLTSAQSVLDSKVM HHHHCHHHHHHHHHH | 25.10 | 29472430 | |
220 | Phosphorylation | SAQSVLDSKVMKIKS CHHHHHHHHHHHHHC | 24.00 | 29472430 | |
221 | Ubiquitination | AQSVLDSKVMKIKSK HHHHHHHHHHHHHCC | 46.12 | - | |
221 | Malonylation | AQSVLDSKVMKIKSK HHHHHHHHHHHHHCC | 46.12 | 26320211 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EBP_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EBP_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EBP_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of EBP_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...