| UniProt ID | EBPL_MOUSE | |
|---|---|---|
| UniProt AC | Q9D0P0 | |
| Protein Name | Emopamil-binding protein-like | |
| Gene Name | Ebpl | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 206 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein. |
|
| Protein Description | Does not possess sterol isomerase activity and does not bind sigma ligands.. | |
| Protein Sequence | MGEHWALGPEAGSSLLLCSALLAVGCALGLRLGRGRSAVERWVLAWLCYDSLVHFVLEGAFVYLSIVGNVADSQGLIASLWKEYGKADTRWLYSDPTVVSLEILTVVLDGLLALVLIYAIVKEKYYRHFVQIVLCVCELYGCWMTFFPEWLVGSPSLNTSSWLYLWVYLVFFNGLWVLIPGLLLWQSWVELKKRDSQEANLAKKHK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of EBPL_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EBPL_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EBPL_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EBPL_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of EBPL_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
