UniProt ID | EBPL_HUMAN | |
---|---|---|
UniProt AC | Q9BY08 | |
Protein Name | Emopamil-binding protein-like | |
Gene Name | EBPL | |
Organism | Homo sapiens (Human). | |
Sequence Length | 206 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
Protein Description | Does not possess sterol isomerase activity and does not bind sigma ligands.. | |
Protein Sequence | MGAEWELGAEAGGSLLLCAALLAAGCALGLRLGRGQGAADRGALIWLCYDALVHFALEGPFVYLSLVGNVANSDGLIASLWKEYGKADARWVYFDPTIVSVEILTVALDGSLALFLIYAIVKEKYYRHFLQITLCVCELYGCWMTFLPEWLTRSPNLNTSNWLYCWLYLFFFNGVWVLIPGLLLWQSWLELKKMHQKETSSVKKFQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
86 | Ubiquitination | SLWKEYGKADARWVY HHHHHHCCCCCEEEE | 42.04 | - | |
199 | Phosphorylation | KKMHQKETSSVKKFQ HHHHHHCCCCCCCCC | 33.08 | 29083192 | |
200 | Phosphorylation | KMHQKETSSVKKFQ- HHHHHCCCCCCCCC- | 33.94 | 29083192 | |
201 | Phosphorylation | MHQKETSSVKKFQ-- HHHHCCCCCCCCC-- | 45.43 | 29083192 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EBPL_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EBPL_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EBPL_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of EBPL_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...