dbPTM

DYRK3_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DYRK3_MOUSE
UniProt AC	Q922Y0
Protein Name	Dual specificity tyrosine-phosphorylation-regulated kinase 3
Gene Name	Dyrk3 {ECO:0000312\|MGI:MGI:1330300}
Organism	Mus musculus (Mouse).
Sequence Length	586
Subcellular Localization	Nucleus . Cytoplasmic granule . Shuttles between cytoplasm and stress granules. Localized predominantly on distinct speckles distributed throughout the cytoplasm of the cell. At low concentration, showns a homogeneous distribution throughout the cyto
Protein Description	Dual-specificity kinase which possesses both serine/threonine and tyrosine kinase activities. Negative regulator of EPO-dependent erythropoiesis, may place an upper limit on red cell production during stress erythropoiesis. Inhibits cell death due to cytokine withdrawal in hematopoietic progenitor cells (By similarity). May act by regulating CREB/CRE signaling. [PubMed: 12356771 Stabilizes and prevents stress granule disassembly thereby regulating mTORC1 signaling during cellular stress. During stressful conditions, DYRK3 partitions to the stress granule from the cytosol, as well as mTORC1 components, which prevents mTORC1 signaling. When stress signals are gone, the kinase activity of DYRK3 is required for the dissolution of stress granule and mTORC1 relocation to the cytosol, and promotes the phosphorylation of the mTORC1 inhibitor, AKT1S1, allowing full reactivation of mTORC1 signaling. Promotes cell survival upon genotoxic stress through phosphorylation of SIRT1. This in turn inhibits TP53 activity and apoptosis (By similarity]
Protein Sequence	MGGAARDRGRKDAALPGAGLPPQQRRLGDGVYDTFMMIDETKGPPYSDTFSNPSEAPVSRRLNITTEPLTRGHTQHFVNGSEMKVEQLFQEFGNRRSNTLQSDGISNSEKSSPASQGKSSESLSAVKCNLSSRPSKVLPLTPEQALKQYKHHLTAYEKLEIVSYPEIYFVGPNAKKRQGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSATKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGCRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMIELLGMPPQKLLEQSKRAKYFINSKGLPRYCSVSTQTDGRVVLLGGRSRRGKKRGPPGSKDWATALKGCGDYLFIEFLKRCLQWDPSARLTPAQALRHPWISKSTPKPLTMDKVPGKRVVNPTNAFQGLGSKLPPVVGIASKLKANLMSETSGSIPLCSVLPKLIS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
208	Phosphorylation	RDHLAYRYEVLKIIG CHHHHHHHEEHHHHC	9.56	22817900
317	Phosphorylation	LVRKFAQSILQSLDA HHHHHHHHHHHHHHH	23.10	17203969
366	Phosphorylation	CFEYQKLYTYIQSRF HHHHHHHHHHHHHHH	12.44	28066266
367	Phosphorylation	FEYQKLYTYIQSRFY HHHHHHHHHHHHHHH	25.28	22499769
368	Phosphorylation	EYQKLYTYIQSRFYR HHHHHHHHHHHHHHC	5.38	22499769
371	Phosphorylation	KLYTYIQSRFYRAPE HHHHHHHHHHHCCCH	18.13	22499769
525	Phosphorylation	HPWISKSTPKPLTMD CCCCCCCCCCCCCCC	38.78	26239621
530	Phosphorylation	KSTPKPLTMDKVPGK CCCCCCCCCCCCCCC	31.67	26239621

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
368	Y	Phosphorylation	Kinase	DYRK3	Q922Y0	PSP

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DYRK3_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DYRK3_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of DYRK3_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DYRK3_MOUSE

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Protein phosphorylation and expression profiling by Yin-yangmultidimensional liquid chromatography (Yin-yang MDLC) massspectrometry."; Dai J., Jin W.-H., Sheng Q.-H., Shieh C.-H., Wu J.-R., Zeng R.; J. Proteome Res. 6:250-262(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-317, AND MASSSPECTROMETRY.	17203969 [Abstract]
"DYRK3 activation, engagement of protein kinase A/cAMP responseelement-binding protein, and modulation of progenitor cell survival."; Li K., Zhao S., Karur V., Wojchowski D.M.; J. Biol. Chem. 277:47052-47060(2002). Cited for: FUNCTION, AND MUTAGENESIS OF LYS-237; TYR-366 AND TYR-368.	12356771 [Abstract]