| UniProt ID | DYL2_RAT | |
|---|---|---|
| UniProt AC | Q78P75 | |
| Protein Name | Dynein light chain 2, cytoplasmic | |
| Gene Name | Dynll2 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 89 | |
| Subcellular Localization | Cytoplasm, cytoskeleton . | |
| Protein Description | Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures (By similarity).. | |
| Protein Sequence | MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 9 | Acetylation | SDRKAVIKNADMSED CCHHHHHHCCCCCHH | 39.21 | 22902405 | |
| 32 | Phosphorylation | ATQAMEKYNIEKDIA HHHHHHHCCCHHHHH | 14.20 | - | |
| 36 | Acetylation | MEKYNIEKDIAAYIK HHHCCCHHHHHHHHH | 51.11 | 22902405 | |
| 43 | Acetylation | KDIAAYIKKEFDKKY HHHHHHHHHHHHCCC | 33.31 | 22902405 | |
| 44 | Acetylation | DIAAYIKKEFDKKYN HHHHHHHHHHHCCCC | 54.80 | 22902405 | |
| 49 | Acetylation | IKKEFDKKYNPTWHC HHHHHHCCCCCCCEE | 52.70 | 72600883 | |
| 53 | Phosphorylation | FDKKYNPTWHCIVGR HHCCCCCCCEEEECC | 24.97 | 23984901 | |
| 64 | Phosphorylation | IVGRNFGSYVTHETK EECCCCHHHCCCCHH | 16.58 | - | |
| 65 | Phosphorylation | VGRNFGSYVTHETKH ECCCCHHHCCCCHHH | 15.11 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DYL2_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DYL2_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DYL2_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of DYL2_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
