dbPTM

DYL2_CAEEL - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DYL2_CAEEL
UniProt AC	Q21557
Protein Name	Probable dynein light chain 2, cytoplasmic
Gene Name	dlc-2
Organism	Caenorhabditis elegans.
Sequence Length	90
Subcellular Localization	Cytoplasm, cytoskeleton.
Protein Description	Acts as one of several non-catalytic accessory components of a dynein complex..
Protein Sequence	MSEEKIEVKETDMEDPQRDMVISVVREAQRLYNIDKDVAAFVKEELDKKFGATWHVICGKCFGSRVSYEMGHFILLKCNKVNVMIYKCGY

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of DYL2_CAEEL !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of DYL2_CAEEL !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DYL2_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DYL2_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of DYL2_CAEEL !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DYL2_CAEEL

Related Literatures of Post-Translational Modification