DXO_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DXO_DROME
• UniProt AC: Q9VXA8
• Protein Name: Decapping nuclease DXO homolog
• Gene Name: CG9125
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 375
• Protein Description: Ribonuclease that specifically degrades pre-mRNAs with a defective 5' end cap and is part of a pre-mRNA capping quality control. Has decapping and pyrophosphohydrolase activities. Has decapping activity toward incomplete 5' end cap mRNAs such as unmethylated 5' end-capped RNA to release GpppN and 5' end monophosphate RNA. Also possesses RNA 5'-pyrophosphohydrolase activity by hydrolyzing the 5' end triphosphate to release pyrophosphates (By similarity)..
• Protein Sequence: MAENAGFISVPWGQHKLGAMYNTPFPSISRPKCIGVCSINASREFVDDASCASYLAGQPWPPLPFDLNGGIEDVIRKPVENGKRDLEIMLTYIKQHQKELLRQSSSDARNLRLDSDFVTLRGILRQIMCLQYDNRSFRVKATLLNGNVYMCKEETPEQQLENANMSRAQRVMCSWGFKFEQYLTSAQAQGKPVTNVPVNEAEEFMGVYRTNLAGILMLYGAELDCVDSKEPVDFKDCRVLDSLKFVELKTSVFNMNPHQIRTFKSFKSANWWSQSFLVGITTLYVGLRDTKGMLQRIDEIDVATLARNKPWSASAMAWYLEQFLRNLKKLLVNINDPFAVVQVTFLNKHASYEVLRGPEHQILPNWYRDLLKTRS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of DXO_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DXO_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DXO_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DXO_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
XRN2_DROME	Rat1	physical	27292797

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.