UniProt ID | DUS18_HUMAN | |
---|---|---|
UniProt AC | Q8NEJ0 | |
Protein Name | Dual specificity protein phosphatase 18 | |
Gene Name | DUSP18 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 188 | |
Subcellular Localization |
Cytoplasm . Nucleus . Mitochondrion inner membrane Peripheral membrane protein Intermembrane side . Translocates to cytoplasm in response to apoptotic stimuli such as staurosporine treatment. |
|
Protein Description | Can dephosphorylate single and diphosphorylated synthetic MAPK peptides, with preference for the phosphotyrosine and diphosphorylated forms over phosphothreonine. In vitro, dephosphorylates p-nitrophenyl phosphate (pNPP).. | |
Protein Sequence | MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTLYEDIQYMQVPVADSPNSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLMKYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFGKNTVHMVSSPVGMIPDIYEKEVRLMIPL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DUS18_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DUS18_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DUS18_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PTN6_HUMAN | PTPN6 | physical | 27880917 | |
DCP1A_HUMAN | DCP1A | physical | 27880917 | |
SNX4_HUMAN | SNX4 | physical | 27880917 | |
GORS2_HUMAN | GORASP2 | physical | 27880917 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...