dbPTM

DUS18_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DUS18_HUMAN
UniProt AC	Q8NEJ0
Protein Name	Dual specificity protein phosphatase 18
Gene Name	DUSP18
Organism	Homo sapiens (Human).
Sequence Length	188
Subcellular Localization	Cytoplasm . Nucleus . Mitochondrion inner membrane Peripheral membrane protein Intermembrane side . Translocates to cytoplasm in response to apoptotic stimuli such as staurosporine treatment.
Protein Description	Can dephosphorylate single and diphosphorylated synthetic MAPK peptides, with preference for the phosphotyrosine and diphosphorylated forms over phosphothreonine. In vitro, dephosphorylates p-nitrophenyl phosphate (pNPP)..
Protein Sequence	MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTLYEDIQYMQVPVADSPNSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLMKYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFGKNTVHMVSSPVGMIPDIYEKEVRLMIPL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
92	Phosphorylation	PIADHIHSVEMKQGR HHHHHCEEEEECCCC	21.12	22210691
100	Phosphorylation	VEMKQGRTLLHCAAG EEECCCCCHHHHCCC	40.26	22210691

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of DUS18_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DUS18_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DUS18_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PTN6_HUMAN	PTPN6	physical	27880917
DCP1A_HUMAN	DCP1A	physical	27880917
SNX4_HUMAN	SNX4	physical	27880917
GORS2_HUMAN	GORASP2	physical	27880917

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DUS18_HUMAN

Related Literatures of Post-Translational Modification