DTX1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DTX1_MOUSE
• UniProt AC: Q61010
• Protein Name: E3 ubiquitin-protein ligase DTX1
• Gene Name: Dtx1
• Organism: Mus musculus (Mouse).
• Sequence Length: 627
• Subcellular Localization: Cytoplasm . Nucleus . Predominantly cytoplasmic. Associates with endocytic vesicles. Partially nuclear.
• Protein Description: Regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. Mainly acts as a positive regulator of Notch, but it also acts as a negative regulator, depending on the developmental and cell context. Mediates the antineural activity of Notch, possibly by inhibiting the transcriptional activation mediated by MATCH1. Involved in neurogenesis, lymphogenesis and myogenesis, and may also be involved in MZB (Marginal zone B) cell differentiation. Promotes B-cell development at the expense of T-cell development, suggesting that it can antagonize NOTCH1. Functions as an ubiquitin ligase protein in vivo, mediating ubiquitination and promoting degradation of MEKK1, suggesting that it may regulate the Notch pathway via some ubiquitin ligase activity..
• Protein Sequence: MSRPGQGVMVPVNGLGFPPQNVARVVVWEWLNEHSRWRPYTATVCHHIENVLKEDARGSVVLGQVDAQLVPYIIDLQSMHQFRQDTGTMRPVRRNFYDPSSAPGKGIVWEWENDGGAWTAYDMDICITIQNAYEKQHPWLDLSSLGFCYLIYFNSMSQMNRQTRRRRRLRRRLDLAYPLTVGSIPKSQSWPVGASSGQPCSCQQCLLVNSTRAASNAILASQRRKAPIAPAAPPAPPPPPPPLPPGGPPGALVVRPSATFAGAALWAAPATGPTEPAPPPGVPPRSPSAPNGAPTPGQNNLSRPGPQRSTSVSARASIPPGVPALPVKNLNGTGPVHPALAGMTGILLCAAGLPVCLTRAPKPILHPPPVSKSDVKPVPGVPGVCRKTKKKHLKKSKNPEDVVRRYMQKVKNPPDEDCTICMERLVTASGYEGVLRNKSVRPELVGRLGRCGHMYHLLCLVAMYSNGNKDGSLQCPTCKAIYGEKTGTQPPGKMEFHLIPHSLPGFADTQTIRIVYDIPTGIQGPEHPNPGKKFTARGFPRHCYLPNNEKGRKVLRLLITAWERRLIFTIGTSNTTGESDTVVWNEIHHKTEFGSNLTGHGYPDASYLDNVLAELTAQGVSEAMAKA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
88	Phosphorylation	QFRQDTGTMRPVRRN HHHHCCCCCCCCCHH	16.46	29895711
180	Phosphorylation	LDLAYPLTVGSIPKS HHHCCCCCCCCCCHH	20.51	21454597
221	Phosphorylation	ASNAILASQRRKAPI HHHHHHHHHHCCCCC	22.30	26824392
486	Phosphorylation	KAIYGEKTGTQPPGK CCCCCCCCCCCCCCE	40.95	27180971
488	Phosphorylation	IYGEKTGTQPPGKME CCCCCCCCCCCCEEE	43.04	27180971

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	Map3k1	P53349	PMID:22199232

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DTX1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DTX1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KPCT_MOUSE	Prkcq	physical	25000980
CBLB_MOUSE	Cblb	physical	25000980

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.