UniProt ID | DSK2B_ARATH | |
---|---|---|
UniProt AC | Q9SII8 | |
Protein Name | Ubiquitin domain-containing protein DSK2b | |
Gene Name | DSK2B | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 551 | |
Subcellular Localization | Nucleus . Cytoplasm . | |
Protein Description | Binds and presumably selects ubiquitin-conjugates for destruction. Prefers multiubiquitin chains rather than single ubiquitins, with a binding affinity for 'Lys-48'-linked ubiquitin chains. Acts as a ubiquitin receptor that associates with the 26S proteasomal docking subunit RPN10 for the indirect recognition of ubiquitinated substrates of ubiquitin/26S proteasome-mediated proteolysis (UPP).. | |
Protein Sequence | MGGEGDSSQPQSGEGEAVAVNIRCSNGTKFSVKTSLDSTVESFKELVAQSSDVPANQQRLIYKGRILKDDQTLLSYGLQADHTIHMVRGSAPSSAPPPAPAASQTTAPSVTRGVGSDNSSNLGGASPGESLFPGLGFNPLGGGNAMSGLFGAGLPDLVQTQQQLAQNPNMIRDMMNTPAIQNLMNNPEFMRSMIMNNPQMRELVDRNPELGHVLNDPSILRQTLEAARNPELMREMMRNTDRAMSNIESMPEGFNMLRRMYENVQEPLMNATTMSGNAGNNTGSNPFAALLGNQGVTTQGSDASNNSSTPNAGTGTIPNANPLPNPWGATGGQTTAPGRTNVGGDARSPGLGGLGGLGSLGGLGGLGMLGADSPLGATPDASQLSQLLQNPAISQMMQSVFSNPQYMNQLMSLNPQLRSMLDSNPQLREMMQNPDFLRQFSSPEMMQQMMTLQQSLSQNRNTASQDAGQTGAATGNNGGLDLLMNMFGSLGAGGLSGTNQSNVPPEERYATQLQQLQEMGFYDRAENIRALLATNGNVNAAVERLLGSIGQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DSK2B_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DSK2B_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DSK2B_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NPL41_ARATH | NPL41 | physical | 21798944 | |
PSMD4_ARATH | RPN10 | physical | 20059542 | |
PSMD4_HUMAN | PSMD4 | physical | 20059542 | |
RPN10_YEAST | RPN10 | physical | 20059542 | |
RPN13_ARATH | RPN13 | physical | 20059542 | |
PEX2_ARATH | TED3 | physical | 23336935 | |
PEX12_ARATH | PEX12 | physical | 23336935 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...