UniProt ID | DRE2_ARATH | |
---|---|---|
UniProt AC | Q8L7Z3 | |
Protein Name | Anamorsin homolog {ECO:0000255|HAMAP-Rule:MF_03115} | |
Gene Name | At5g18400 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 272 | |
Subcellular Localization | Cytoplasm . Mitochondrion intermembrane space . | |
Protein Description | Component of the cytosolic iron-sulfur (Fe-S) protein assembly (CIA) machinery. Required for the maturation of extramitochondrial Fe-S proteins. Part of an electron transfer chain functioning in an early step of cytosolic Fe-S biogenesis, facilitating the de novo assembly of a [4Fe-4S] cluster on the cytosolic Fe-S scaffold complex. Electrons are transferred from NADPH via FAD- and FMN-containing diflavin oxidoreductase TAH18/ATR3. [PubMed: 23754812 Together with the diflavin oxidoreductase, also required for the assembly of the diferric tyrosyl radical cofactor of ribonucleotide reductase (RNR), probably by providing electrons for reduction during radical cofactor maturation in the catalytic small subunit (By similarity Required for embryo development] | |
Protein Sequence | MDSMMNQKTVLAVTDDVVLPVSSVLAIMKELGKEVIESFDPLIITQASTINQFPLDASSVEAVLAISKTSDFPSDKICGEFSRILKPGGTVSVCKVLEGETGEIQQTIQRRVTLAGFLEPQCLDLKSIKLSTFSLSFGIKAKKPSWKIGSSFALKKPVTNLFKIDLDDDVDLIDEDSLLTEEDLMKPQLPVASGCETTKKACKNCVCGRAEIEEKAVKLGLTEDQIENPQSSCGSCGLGDAFRCGTCPYKGLPPFKLGEKVTLSQNFLEADI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DRE2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DRE2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DRE2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of DRE2_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...