dbPTM

DRE2_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DRE2_ARATH
UniProt AC	Q8L7Z3
Protein Name	Anamorsin homolog {ECO:0000255\|HAMAP-Rule:MF_03115}
Gene Name	At5g18400
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	272
Subcellular Localization	Cytoplasm . Mitochondrion intermembrane space .
Protein Description	Component of the cytosolic iron-sulfur (Fe-S) protein assembly (CIA) machinery. Required for the maturation of extramitochondrial Fe-S proteins. Part of an electron transfer chain functioning in an early step of cytosolic Fe-S biogenesis, facilitating the de novo assembly of a [4Fe-4S] cluster on the cytosolic Fe-S scaffold complex. Electrons are transferred from NADPH via FAD- and FMN-containing diflavin oxidoreductase TAH18/ATR3. [PubMed: 23754812 Together with the diflavin oxidoreductase, also required for the assembly of the diferric tyrosyl radical cofactor of ribonucleotide reductase (RNR), probably by providing electrons for reduction during radical cofactor maturation in the catalytic small subunit (By similarity Required for embryo development]
Protein Sequence	MDSMMNQKTVLAVTDDVVLPVSSVLAIMKELGKEVIESFDPLIITQASTINQFPLDASSVEAVLAISKTSDFPSDKICGEFSRILKPGGTVSVCKVLEGETGEIQQTIQRRVTLAGFLEPQCLDLKSIKLSTFSLSFGIKAKKPSWKIGSSFALKKPVTNLFKIDLDDDVDLIDEDSLLTEEDLMKPQLPVASGCETTKKACKNCVCGRAEIEEKAVKLGLTEDQIENPQSSCGSCGLGDAFRCGTCPYKGLPPFKLGEKVTLSQNFLEADI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
150	Phosphorylation	KPSWKIGSSFALKKP CCCCEECCCCCCCCC	26.25	25561503
151	Phosphorylation	PSWKIGSSFALKKPV CCCEECCCCCCCCCC	14.88	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of DRE2_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DRE2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DRE2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of DRE2_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DRE2_ARATH

Related Literatures of Post-Translational Modification